· 6 years ago · Oct 27, 2019, 07:40 PM
1Oct 27 20:17:43 localhost epgd: EPG Update started
2Oct 27 20:17:43 localhost epgd: Updating 'tvm' day today+0 now
3Oct 27 20:17:43 localhost epgd: Checking tvm id 1
4 Oct 27 20:18:09 localhost systemd-modules-load[384]: Inserted module 'iscsi_tcp'
5Oct 27 20:18:09 localhost systemd-modules-load[384]: Inserted module 'ib_iser'
6Oct 27 20:18:09 localhost systemd[1]: Mounted FUSE Control File System.
7Oct 27 20:18:09 localhost systemd[1]: Mounted Kernel Configuration File System.
8Oct 27 20:18:09 localhost systemd[1]: Starting Flush Journal to Persistent Storage...
9Oct 27 20:18:09 localhost blkmapd[424]: open pipe file /run/rpc_pipefs/nfs/blocklayout failed: No such file or directory
10Oct 27 20:18:09 localhost systemd[1]: Started Apply Kernel Variables.
11Oct 27 20:18:09 localhost systemd[1]: Started Create list of required static device nodes for the current kernel.
12Oct 27 20:18:09 localhost systemd[1]: Starting Create Static Device Nodes in /dev...
13Oct 27 20:18:09 localhost systemd[1]: Mounted RPC Pipe File System.
14Oct 27 20:18:09 localhost systemd[1]: Starting pNFS block layout mapping daemon...
15Oct 27 20:18:09 localhost systemd[1]: nfs-blkmap.service: Can't open PID file /run/blkmapd.pid (yet?) after start: No such file or directory
16Oct 27 20:18:09 localhost systemd[1]: Started pNFS block layout mapping daemon.
17Oct 27 20:18:09 localhost systemd[1]: Mounted NFSD configuration filesystem.
18Oct 27 20:18:09 localhost systemd[1]: Started Monitoring of LVM2 mirrors, snapshots etc. using dmeventd or progress polling.
19Oct 27 20:18:09 localhost systemd[1]: Started Set the console keyboard layout.
20Oct 27 20:18:09 localhost systemd[1]: Started Create Static Device Nodes in /dev.
21Oct 27 20:18:09 localhost systemd[1]: Reached target Local File Systems (Pre).
22Oct 27 20:18:09 localhost systemd[1]: Starting udev Kernel Device Manager...
23Oct 27 20:18:09 localhost systemd[1]: Started udev Kernel Device Manager.
24Oct 27 20:18:09 localhost systemd[1]: Starting Show Plymouth Boot Screen...
25Oct 27 20:18:09 localhost systemd[1]: Started Show Plymouth Boot Screen.
26Oct 27 20:18:09 localhost systemd[1]: Reached target Local Encrypted Volumes.
27Oct 27 20:18:09 localhost systemd[1]: Started Forward Password Requests to Plymouth Directory Watch.
28Oct 27 20:18:09 localhost systemd[1]: Starting Show Plymouth Boot Screen...
29Oct 27 20:18:09 localhost systemd[1]: Started Show Plymouth Boot Screen.
30Oct 27 20:18:09 localhost systemd[1]: Started Flush Journal to Persistent Storage.
31Oct 27 20:18:09 localhost systemd-udevd[432]: link_config: autonegotiation is unset or enabled, the speed and duplex are not writable.
32Oct 27 20:18:09 localhost systemd-udevd[430]: link_config: autonegotiation is unset or enabled, the speed and duplex are not writable.
33Oct 27 20:18:09 localhost systemd[1]: Listening on Load/Save RF Kill Switch Status /dev/rfkill Watch.
34Oct 27 20:18:09 localhost systemd[1]: Reached target Sound Card.
35Oct 27 20:18:09 localhost systemd[1]: Found device WDC_WD30EFRX-68AX9N0 4.
36Oct 27 20:18:09 localhost systemd[1]: Starting File System Check on /dev/disk/by-uuid/87a6fe9e-d135-4bfc-906c-a4cf854d0206...
37Oct 27 20:18:09 localhost systemd[1]: Started File System Check Daemon to report status.
38Oct 27 20:18:09 localhost systemd[1]: Found device KINGSTON_SA400S37120G 2.
39Oct 27 20:18:09 localhost systemd[1]: Activating swap /dev/disk/by-uuid/7465d9bf-bdf6-4d0e-846d-1f4231df5e43...
40Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter0/demux0.
41Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter0/dvr0.
42Oct 27 20:18:09 localhost systemd-fsck[652]: /dev/sda4: Journal wird wiederhergestellt
43Oct 27 20:18:09 localhost systemd[1]: Activated swap /dev/disk/by-uuid/7465d9bf-bdf6-4d0e-846d-1f4231df5e43.
44Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter0/net0.
45Oct 27 20:18:09 localhost systemd[1]: Reached target Swap.
46Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter0/frontend0.
47Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter1/demux0.
48Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter1/dvr0.
49Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter1/net0.
50Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter1/frontend0.
51Oct 27 20:18:09 localhost systemd[1]: Starting Show Plymouth Boot Screen...
52Oct 27 20:18:09 localhost systemd[1]: Started Show Plymouth Boot Screen.
53Oct 27 20:18:09 localhost systemd-fsck[652]: /dev/sda4: sauber, 70984/175177728 Dateien, 646892618/700683593 Blöcke
54Oct 27 20:18:09 localhost systemd[1]: Started File System Check on /dev/disk/by-uuid/87a6fe9e-d135-4bfc-906c-a4cf854d0206.
55Oct 27 20:18:09 localhost systemd[1]: Mounting /srv...
56Oct 27 20:18:09 localhost systemd[1]: Mounted /srv.
57Oct 27 20:18:09 localhost systemd[1]: Reached target Local File Systems.
58Oct 27 20:18:09 localhost systemd[1]: Starting Preprocess NFS configuration...
59Oct 27 20:18:09 localhost systemd[1]: Starting AppArmor initialization...
60Oct 27 20:18:09 localhost systemd[1]: Starting Set console font and keymap...
61Oct 27 20:18:09 localhost systemd[1]: Starting Create Volatile Files and Directories...
62Oct 27 20:18:09 localhost systemd[1]: Starting ebtables ruleset management...
63Oct 27 20:18:09 localhost systemd[1]: Starting Tell Plymouth To Write Out Runtime Data...
64Oct 27 20:18:09 localhost systemd[1]: Started Preprocess NFS configuration.
65Oct 27 20:18:09 localhost systemd[1]: Reached target NFS client services.
66Oct 27 20:18:09 localhost systemd[1]: Starting NFSv4 ID-name mapping service...
67Oct 27 20:18:09 localhost systemd[1]: Started Set console font and keymap.
68Oct 27 20:18:09 localhost systemd[1]: Started NFSv4 ID-name mapping service.
69Oct 27 20:18:09 localhost systemd[1]: Started Tell Plymouth To Write Out Runtime Data.
70Oct 27 20:18:09 localhost systemd[1]: Started Create Volatile Files and Directories.
71Oct 27 20:18:09 localhost systemd[1]: Starting Update UTMP about System Boot/Shutdown...
72Oct 27 20:18:09 localhost systemd[1]: Starting Network Time Synchronization...
73Oct 27 20:18:09 localhost systemd[1]: Starting RPC bind portmap service...
74Oct 27 20:18:09 localhost systemd[1]: Started RPC bind portmap service.
75Oct 27 20:18:09 localhost systemd[1]: Reached target RPC Port Mapper.
76Oct 27 20:18:09 localhost systemd[1]: Started Update UTMP about System Boot/Shutdown.
77Oct 27 20:18:09 localhost systemd[1]: Received SIGRTMIN+20 from PID 280 (plymouthd).
78Oct 27 20:18:09 localhost systemd[1]: Started ebtables ruleset management.
79Oct 27 20:18:09 localhost apparmor[728]: * Starting AppArmor profiles
80Oct 27 20:18:09 localhost systemd[1]: Reached target Network (Pre).
81Oct 27 20:18:09 localhost systemd[1]: Starting Network Service...
82Oct 27 20:18:09 localhost systemd-networkd[765]: Enumeration completed
83Oct 27 20:18:09 localhost systemd[1]: Started Network Service.
84Oct 27 20:18:09 localhost systemd-networkd[765]: lo: Link is not managed by us
85Oct 27 20:18:09 localhost systemd-networkd[765]: enp5s0: IPv6 successfully enabled
86Oct 27 20:18:09 localhost systemd[1]: Starting Network Name Resolution...
87Oct 27 20:18:09 localhost systemd[1]: Starting Wait for Network to be Configured...
88Oct 27 20:18:09 localhost systemd-networkd-wait-online[791]: ignoring: lo
89Oct 27 20:18:09 localhost systemd[1]: Started Network Time Synchronization.
90Oct 27 20:18:09 localhost systemd[1]: Reached target System Time Synchronized.
91Oct 27 20:18:09 localhost systemd-networkd-wait-online[791]: ignoring: lo
92Oct 27 20:18:09 localhost systemd-networkd[765]: enp5s0: Gained carrier
93Oct 27 20:18:09 localhost systemd-networkd-wait-online[791]: ignoring: lo
94Oct 27 20:18:09 localhost systemd-timesyncd[762]: Network configuration changed, trying to establish connection.
95Oct 27 20:18:09 localhost apparmor[728]: Skipping profile in /etc/apparmor.d/disable: usr.bin.firefox
96Oct 27 20:18:09 localhost apparmor[728]: Skipping profile in /etc/apparmor.d/disable: usr.sbin.rsyslogd
97Oct 27 20:18:09 localhost apparmor[728]: ...done.
98Oct 27 20:18:09 localhost systemd-resolved[790]: Positive Trust Anchors:
99Oct 27 20:18:09 localhost systemd-resolved[790]: . IN DS 19036 8 2 49aac11d7b6f6446702e54a1607371607a1a41855200fd2ce1cdde32f24e8fb5
100Oct 27 20:18:09 localhost systemd-resolved[790]: . IN DS 20326 8 2 e06d44b80b8f1d39a95c0b0d7c65d08458e880409bbc683457104237c7f8ec8d
101Oct 27 20:18:09 localhost systemd-resolved[790]: Negative trust anchors: 10.in-addr.arpa 16.172.in-addr.arpa 17.172.in-addr.arpa 18.172.in-addr.arpa 19.172.in-addr.arpa 20.172.in-addr.arpa 21.172.in-addr.arpa 22.172.in-addr.arpa 23.172.in-addr.arpa 24.172.in-addr.arpa 25.172.in-addr.arpa 26.172.in-addr.arpa 27.172.in-addr.arpa 28.172.in-addr.arpa 29.172.in-addr.arpa 30.172.in-addr.arpa 31.172.in-addr.arpa 168.192.in-addr.arpa d.f.ip6.arpa corp home internal intranet lan local private test
102Oct 27 20:18:09 localhost systemd-resolved[790]: Using system hostname 'myVDR'.
103Oct 27 20:18:09 localhost systemd[1]: Started Network Name Resolution.
104Oct 27 20:18:09 localhost systemd[1]: Reached target Host and Network Name Lookups.
105Oct 27 20:18:09 localhost systemd[1]: Started AppArmor initialization.
106Oct 27 20:18:09 localhost systemd[1]: Reached target System Initialization.
107Oct 27 20:18:09 localhost systemd[1]: Listening on ACPID Listen Socket.
108Oct 27 20:18:09 localhost systemd[1]: Listening on Open-iSCSI iscsid Socket.
109Oct 27 20:18:09 localhost systemd[1]: Listening on Avahi mDNS/DNS-SD Stack Activation Socket.
110Oct 27 20:18:09 localhost systemd[1]: Started ACPI Events Check.
111Oct 27 20:18:09 localhost systemd[1]: Started Daily apt download activities.
112Oct 27 20:18:09 localhost systemd[1]: Listening on eventlircd.socket.
113Oct 27 20:18:09 localhost systemd[1]: Starting Socket activation for snappy daemon.
114Oct 27 20:18:09 localhost systemd[1]: Listening on UUID daemon activation socket.
115Oct 27 20:18:09 localhost systemd[1]: Started Trigger anacron every hour.
116Oct 27 20:18:09 localhost systemd[1]: Started Discard unused blocks once a week.
117Oct 27 20:18:09 localhost systemd[1]: Listening on D-Bus System Message Bus Socket.
118Oct 27 20:18:09 localhost systemd[1]: Started Daily Cleanup of Temporary Directories.
119Oct 27 20:18:09 localhost systemd[1]: Started Daily apt upgrade and clean activities.
120Oct 27 20:18:09 localhost systemd[1]: Started Message of the Day.
121Oct 27 20:18:09 localhost systemd[1]: Reached target Timers.
122Oct 27 20:18:09 localhost systemd[1]: Starting LXD - unix socket.
123Oct 27 20:18:09 localhost systemd[1]: Reached target Paths.
124Oct 27 20:18:09 localhost systemd[1]: Listening on Socket activation for snappy daemon.
125Oct 27 20:18:09 localhost systemd[1]: Listening on LXD - unix socket.
126Oct 27 20:18:09 localhost systemd[1]: Reached target Sockets.
127Oct 27 20:18:09 localhost systemd[1]: Reached target Basic System.
128Oct 27 20:18:09 localhost systemd[1]: Started Run anacron jobs.
129Oct 27 20:18:09 localhost systemd[1]: Starting LXD - container startup/shutdown...
130Oct 27 20:18:09 localhost systemd[1]: Started VDR ACPI power button handling daemon.
131Oct 27 20:18:09 localhost anacron[849]: Anacron 2.3 started on 2019-10-27
132Oct 27 20:18:09 localhost systemd[1]: Starting wait-for-dvb@0.service...
133Oct 27 20:18:09 localhost systemd[1]: Started Handle events from IR remotes decoded by lircd(8).
134Oct 27 20:18:09 localhost anacron[849]: Normal exit (0 jobs run)
135Oct 27 20:18:09 localhost systemd[1]: Started "eventlircd reads from kernel input devices and generates key presses on a lircd socket".
136Oct 27 20:18:09 localhost wait-for-dvb: got device 0
137Oct 27 20:18:09 localhost systemd[1]: Started Deferred execution scheduler.
138Oct 27 20:18:09 localhost systemd[1]: Starting Avahi mDNS/DNS-SD Stack...
139Oct 27 20:18:09 localhost systemd[1]: Starting wait-for-dvb@1.service...
140Oct 27 20:18:09 localhost systemd[1]: Starting Dispatcher daemon for systemd-networkd...
141Oct 27 20:18:09 localhost systemd[1]: Starting Login Service...
142Oct 27 20:18:09 localhost wait-for-dvb: got device 1
143Oct 27 20:18:09 localhost systemd[1]: Started Regular background program processing daemon.
144Oct 27 20:18:09 localhost systemd[1]: Starting LSB: Record successful boot for GRUB...
145Oct 27 20:18:09 localhost systemd[1]: Starting System Logging Service...
146Oct 27 20:18:09 localhost cron[869]: (CRON) INFO (pidfile fd = 3)
147Oct 27 20:18:09 localhost systemd[1]: Started Set the CPU Frequency Scaling governor.
148Oct 27 20:18:09 localhost systemd[1]: Starting Snappy daemon...
149Oct 27 20:18:09 localhost systemd[1]: Starting Initialize hardware monitoring sensors...
150Oct 27 20:18:09 localhost systemd[1]: Started irqbalance daemon.
151Oct 27 20:18:09 localhost systemd[1]: Started FUSE filesystem for LXC.
152Oct 27 20:18:09 localhost systemd[1]: Starting lircd(8) initialization helper tool...
153Oct 27 20:18:09 localhost systemd[1]: Starting Disk Manager...
154Oct 27 20:18:09 localhost systemd[1]: Starting Save/Restore Sound Card State...
155Oct 27 20:18:09 localhost systemd[1]: Starting Accounts Service...
156Oct 27 20:18:09 localhost systemd[1]: Started D-Bus System Message Bus.
157Oct 27 20:18:09 localhost dbus-daemon[883]: [system] AppArmor D-Bus mediation is enabled
158Oct 27 20:18:09 localhost systemd[1]: Starting WPA supplicant...
159Oct 27 20:18:09 localhost systemd[1]: Started lifeguard for system services.
160Oct 27 20:18:09 localhost systemd[1]: Started wait-for-dvb@0.service.
161Oct 27 20:18:09 localhost systemd[1]: Started wait-for-dvb@1.service.
162Oct 27 20:18:09 localhost avahi-daemon[860]: Found user 'avahi' (UID 113) and group 'avahi' (GID 117).
163Oct 27 20:18:09 localhost kernel: [ 0.000000] microcode: microcode updated early to revision 0x2f, date = 2019-02-17
164Oct 27 20:18:09 localhost kernel: [ 0.000000] Linux version 4.15.0-66-generic (buildd@lgw01-amd64-044) (gcc version 7.4.0 (Ubuntu 7.4.0-1ubuntu1~18.04.1)) #75-Ubuntu SMP Tue Oct 1 05:24:09 UTC 2019 (Ubuntu 4.15.0-66.75-generic 4.15.18)
165Oct 27 20:18:09 localhost kernel: [ 0.000000] Command line: BOOT_IMAGE=/boot/vmlinuz-4.15.0-66-generic root=UUID=3a2488fb-8ae8-4722-b647-c95071d7e0af ro quiet splash vt.handoff=1
166Oct 27 20:18:09 localhost kernel: [ 0.000000] KERNEL supported cpus:
167Oct 27 20:18:09 localhost kernel: [ 0.000000] Intel GenuineIntel
168Oct 27 20:18:09 localhost kernel: [ 0.000000] AMD AuthenticAMD
169Oct 27 20:18:09 localhost kernel: [ 0.000000] Centaur CentaurHauls
170Oct 27 20:18:09 localhost kernel: [ 0.000000] x86/fpu: Supporting XSAVE feature 0x001: 'x87 floating point registers'
171Oct 27 20:18:09 localhost kernel: [ 0.000000] x86/fpu: Supporting XSAVE feature 0x002: 'SSE registers'
172Oct 27 20:18:09 localhost kernel: [ 0.000000] x86/fpu: Enabled xstate features 0x3, context size is 576 bytes, using 'standard' format.
173Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: BIOS-provided physical RAM map:
174Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x0000000000000000-0x000000000009d7ff] usable
175Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x000000000009d800-0x000000000009ffff] reserved
176Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000000e0000-0x00000000000fffff] reserved
177Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x0000000000100000-0x00000000df58ffff] usable
178Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df590000-0x00000000df5d5fff] ACPI NVS
179Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df5d6000-0x00000000df5ddfff] ACPI data
180Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df5de000-0x00000000df60afff] reserved
181Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df60b000-0x00000000df60bfff] usable
182Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df60c000-0x00000000df60cfff] ACPI data
183Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df60d000-0x00000000df615fff] ACPI NVS
184Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df616000-0x00000000df63dfff] reserved
185Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df63e000-0x00000000df680fff] ACPI NVS
186Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df681000-0x00000000df7fffff] usable
187Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000fed1c000-0x00000000fed3ffff] reserved
188Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000ff000000-0x00000000ffffffff] reserved
189Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x0000000100000000-0x000000011f7fffff] usable
190Oct 27 20:18:09 localhost kernel: [ 0.000000] NX (Execute Disable) protection: active
191Oct 27 20:18:09 localhost kernel: [ 0.000000] SMBIOS 2.7 present.
192Oct 27 20:18:09 localhost kernel: [ 0.000000] DMI: To Be Filled By O.E.M. To Be Filled By O.E.M./H61M-GE, BIOS P1.30 08/31/2011
193Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: update [mem 0x00000000-0x00000fff] usable ==> reserved
194Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: remove [mem 0x000a0000-0x000fffff] usable
195Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: last_pfn = 0x11f800 max_arch_pfn = 0x400000000
196Oct 27 20:18:09 localhost kernel: [ 0.000000] MTRR default type: uncachable
197Oct 27 20:18:09 localhost kernel: [ 0.000000] MTRR fixed ranges enabled:
198Oct 27 20:18:09 localhost kernel: [ 0.000000] 00000-9FFFF write-back
199Oct 27 20:18:09 localhost kernel: [ 0.000000] A0000-BFFFF uncachable
200Oct 27 20:18:09 localhost kernel: [ 0.000000] C0000-CFFFF write-protect
201Oct 27 20:18:09 localhost kernel: [ 0.000000] D0000-E7FFF uncachable
202Oct 27 20:18:09 localhost kernel: [ 0.000000] E8000-FFFFF write-protect
203Oct 27 20:18:09 localhost kernel: [ 0.000000] MTRR variable ranges enabled:
204Oct 27 20:18:09 localhost kernel: [ 0.000000] 0 base 000000000 mask F00000000 write-back
205Oct 27 20:18:09 localhost kernel: [ 0.000000] 1 base 100000000 mask FE0000000 write-back
206Oct 27 20:18:09 localhost kernel: [ 0.000000] 2 base 0E0000000 mask FE0000000 uncachable
207Oct 27 20:18:09 localhost kernel: [ 0.000000] 3 base 11F800000 mask FFF800000 uncachable
208Oct 27 20:18:09 localhost kernel: [ 0.000000] 4 disabled
209Oct 27 20:18:09 localhost kernel: [ 0.000000] 5 disabled
210Oct 27 20:18:09 localhost kernel: [ 0.000000] 6 disabled
211Oct 27 20:18:09 localhost kernel: [ 0.000000] 7 disabled
212Oct 27 20:18:09 localhost kernel: [ 0.000000] 8 disabled
213Oct 27 20:18:09 localhost kernel: [ 0.000000] 9 disabled
214Oct 27 20:18:09 localhost kernel: [ 0.000000] x86/PAT: Configuration [0-7]: WB WC UC- UC WB WP UC- WT
215Oct 27 20:18:09 localhost kernel: [ 0.000000] total RAM covered: 4088M
216Oct 27 20:18:09 localhost kernel: [ 0.000000] Found optimal setting for mtrr clean up
217Oct 27 20:18:09 localhost kernel: [ 0.000000] gran_size: 64K chunk_size: 16M num_reg: 5 lose cover RAM: 0G
218Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: update [mem 0xe0000000-0xffffffff] usable ==> reserved
219Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: last_pfn = 0xdf800 max_arch_pfn = 0x400000000
220Oct 27 20:18:09 localhost kernel: [ 0.000000] found SMP MP-table at [mem 0x000fceb0-0x000fcebf]
221Oct 27 20:18:09 localhost kernel: [ 0.000000] Scanning 1 areas for low memory corruption
222Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38141000, 0x38141fff] PGTABLE
223Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38142000, 0x38142fff] PGTABLE
224Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38143000, 0x38143fff] PGTABLE
225Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38144000, 0x38144fff] PGTABLE
226Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38145000, 0x38145fff] PGTABLE
227Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38146000, 0x38146fff] PGTABLE
228Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38147000, 0x38147fff] PGTABLE
229Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38148000, 0x38148fff] PGTABLE
230Oct 27 20:18:09 localhost kernel: [ 0.000000] RAMDISK: [mem 0x2f9c9000-0x33cdbfff]
231Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: Early table checksum verification disabled
232Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: RSDP 0x00000000000F0450 000024 (v02 ALASKA)
233Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: XSDT 0x00000000DF5D6068 000054 (v01 ALASKA A M I 01072009 AMI 00010013)
234Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: FACP 0x00000000DF5DD6A8 0000F4 (v04 ALASKA A M I 01072009 AMI 00010013)
235Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: DSDT 0x00000000DF5D6150 007556 (v02 ALASKA A M I 00000000 INTL 20051117)
236Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: FACS 0x00000000DF60DF80 000040
237Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: APIC 0x00000000DF5DD7A0 000062 (v03 ALASKA A M I 01072009 AMI 00010013)
238Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: SSDT 0x00000000DF5DD808 000098 (v01 AMICPU PROC 00000001 MSFT 03000001)
239Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: MCFG 0x00000000DF5DD8A0 00003C (v01 ALASKA A M I 01072009 MSFT 00000097)
240Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: AAFT 0x00000000DF5DD8E0 0000BA (v01 ALASKA OEMAAFT 01072009 MSFT 00000097)
241Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: HPET 0x00000000DF5DD9A0 000038 (v01 ALASKA A M I 01072009 AMI. 00000004)
242Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: Local APIC address 0xfee00000
243Oct 27 20:18:09 localhost kernel: [ 0.000000] No NUMA configuration found
244Oct 27 20:18:09 localhost kernel: [ 0.000000] Faking a node at [mem 0x0000000000000000-0x000000011f7fffff]
245Oct 27 20:18:09 localhost kernel: [ 0.000000] NODE_DATA(0) allocated [mem 0x11f7d3000-0x11f7fdfff]
246Oct 27 20:18:09 localhost kernel: [ 0.000000] tsc: Fast TSC calibration using PIT
247Oct 27 20:18:09 localhost kernel: [ 0.000000] Zone ranges:
248Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA [mem 0x0000000000001000-0x0000000000ffffff]
249Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA32 [mem 0x0000000001000000-0x00000000ffffffff]
250Oct 27 20:18:09 localhost kernel: [ 0.000000] Normal [mem 0x0000000100000000-0x000000011f7fffff]
251Oct 27 20:18:09 localhost kernel: [ 0.000000] Device empty
252Oct 27 20:18:09 localhost kernel: [ 0.000000] Movable zone start for each node
253Oct 27 20:18:09 localhost kernel: [ 0.000000] Early memory node ranges
254Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x0000000000001000-0x000000000009cfff]
255Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x0000000000100000-0x00000000df58ffff]
256Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x00000000df60b000-0x00000000df60bfff]
257Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x00000000df681000-0x00000000df7fffff]
258Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x0000000100000000-0x000000011f7fffff]
259Oct 27 20:18:09 localhost kernel: [ 0.000000] Reserved but unavailable: 100 pages
260Oct 27 20:18:09 localhost kernel: [ 0.000000] Initmem setup node 0 [mem 0x0000000000001000-0x000000011f7fffff]
261Oct 27 20:18:09 localhost kernel: [ 0.000000] On node 0 totalpages: 1044140
262Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA zone: 64 pages used for memmap
263Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA zone: 21 pages reserved
264Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA zone: 3996 pages, LIFO batch:0
265Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA32 zone: 14237 pages used for memmap
266Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA32 zone: 911120 pages, LIFO batch:31
267Oct 27 20:18:09 localhost kernel: [ 0.000000] Normal zone: 2016 pages used for memmap
268Oct 27 20:18:09 localhost kernel: [ 0.000000] Normal zone: 129024 pages, LIFO batch:31
269Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: PM-Timer IO Port: 0x408
270Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: Local APIC address 0xfee00000
271Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: LAPIC_NMI (acpi_id[0xff] high edge lint[0x1])
272Oct 27 20:18:09 localhost kernel: [ 0.000000] IOAPIC[0]: apic_id 0, version 32, address 0xfec00000, GSI 0-23
273Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: INT_SRC_OVR (bus 0 bus_irq 0 global_irq 2 dfl dfl)
274Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: INT_SRC_OVR (bus 0 bus_irq 9 global_irq 9 high level)
275Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: IRQ0 used by override.
276Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: IRQ9 used by override.
277Oct 27 20:18:09 localhost kernel: [ 0.000000] Using ACPI (MADT) for SMP configuration information
278Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: HPET id: 0x8086a701 base: 0xfed00000
279Oct 27 20:18:09 localhost kernel: [ 0.000000] smpboot: Allowing 2 CPUs, 0 hotplug CPUs
280Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x00000000-0x00000fff]
281Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x0009d000-0x0009dfff]
282Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x0009e000-0x0009ffff]
283Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x000a0000-0x000dffff]
284Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x000e0000-0x000fffff]
285Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf590000-0xdf5d5fff]
286Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf5d6000-0xdf5ddfff]
287Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf5de000-0xdf60afff]
288Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf60c000-0xdf60cfff]
289Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf60d000-0xdf615fff]
290Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf616000-0xdf63dfff]
291Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf63e000-0xdf680fff]
292Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf800000-0xfed1bfff]
293Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xfed1c000-0xfed3ffff]
294Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xfed40000-0xfeffffff]
295Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xff000000-0xffffffff]
296Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: [mem 0xdf800000-0xfed1bfff] available for PCI devices
297Oct 27 20:18:09 localhost kernel: [ 0.000000] Booting paravirtualized kernel on bare hardware
298Oct 27 20:18:09 localhost kernel: [ 0.000000] clocksource: refined-jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 7645519600211568 ns
299Oct 27 20:18:09 localhost kernel: [ 0.000000] random: get_random_bytes called from start_kernel+0x99/0x4fd with crng_init=0
300Oct 27 20:18:09 localhost kernel: [ 0.000000] setup_percpu: NR_CPUS:8192 nr_cpumask_bits:2 nr_cpu_ids:2 nr_node_ids:1
301Oct 27 20:18:09 localhost kernel: [ 0.000000] percpu: Embedded 46 pages/cpu s151552 r8192 d28672 u1048576
302Oct 27 20:18:09 localhost kernel: [ 0.000000] pcpu-alloc: s151552 r8192 d28672 u1048576 alloc=1*2097152
303Oct 27 20:18:09 localhost kernel: [ 0.000000] pcpu-alloc: [0] 0 1
304Oct 27 20:18:09 localhost kernel: [ 0.000000] Built 1 zonelists, mobility grouping on. Total pages: 1027802
305Oct 27 20:18:09 localhost kernel: [ 0.000000] Policy zone: Normal
306Oct 27 20:18:09 localhost kernel: [ 0.000000] Kernel command line: BOOT_IMAGE=/boot/vmlinuz-4.15.0-66-generic root=UUID=3a2488fb-8ae8-4722-b647-c95071d7e0af ro quiet splash vt.handoff=1
307Oct 27 20:18:09 localhost kernel: [ 0.000000] Calgary: detecting Calgary via BIOS EBDA area
308Oct 27 20:18:09 localhost kernel: [ 0.000000] Calgary: Unable to locate Rio Grande table in EBDA - bailing!
309Oct 27 20:18:09 localhost kernel: [ 0.000000] Memory: 3947744K/4176560K available (12300K kernel code, 2481K rwdata, 4260K rodata, 2436K init, 2388K bss, 228816K reserved, 0K cma-reserved)
310Oct 27 20:18:09 localhost kernel: [ 0.000000] SLUB: HWalign=64, Order=0-3, MinObjects=0, CPUs=2, Nodes=1
311Oct 27 20:18:09 localhost kernel: [ 0.000000] Kernel/User page tables isolation: enabled
312Oct 27 20:18:09 localhost kernel: [ 0.000000] ftrace: allocating 39306 entries in 154 pages
313Oct 27 20:18:09 localhost kernel: [ 0.000000] Hierarchical RCU implementation.
314Oct 27 20:18:09 localhost kernel: [ 0.000000] RCU restricting CPUs from NR_CPUS=8192 to nr_cpu_ids=2.
315Oct 27 20:18:09 localhost kernel: [ 0.000000] Tasks RCU enabled.
316Oct 27 20:18:09 localhost kernel: [ 0.000000] RCU: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=2
317Oct 27 20:18:09 localhost kernel: [ 0.000000] NR_IRQS: 524544, nr_irqs: 440, preallocated irqs: 16
318Oct 27 20:18:09 localhost kernel: [ 0.000000] vt handoff: transparent VT on vt#1
319Oct 27 20:18:09 localhost kernel: [ 0.000000] Console: colour dummy device 80x25
320Oct 27 20:18:09 localhost kernel: [ 0.000000] console [tty0] enabled
321Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: Core revision 20170831
322Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: 2 ACPI AML tables successfully acquired and loaded
323Oct 27 20:18:09 localhost kernel: [ 0.000000] clocksource: hpet: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 133484882848 ns
324Oct 27 20:18:09 localhost kernel: [ 0.000000] hpet clockevent registered
325Oct 27 20:18:09 localhost kernel: [ 0.000000] APIC: Switch to symmetric I/O mode setup
326Oct 27 20:18:09 localhost kernel: [ 0.000000] ..TIMER: vector=0x30 apic1=0 pin1=2 apic2=-1 pin2=-1
327Oct 27 20:18:09 localhost kernel: [ 0.020000] tsc: Fast TSC calibration using PIT
328Oct 27 20:18:09 localhost kernel: [ 0.024000] tsc: Detected 2394.533 MHz processor
329Oct 27 20:18:09 localhost kernel: [ 0.024000] Calibrating delay loop (skipped), value calculated using timer frequency.. 4789.06 BogoMIPS (lpj=9578132)
330Oct 27 20:18:09 localhost kernel: [ 0.024000] pid_max: default: 32768 minimum: 301
331Oct 27 20:18:09 localhost kernel: [ 0.024000] Security Framework initialized
332Oct 27 20:18:09 localhost kernel: [ 0.024000] Yama: becoming mindful.
333Oct 27 20:18:09 localhost kernel: [ 0.024000] AppArmor: AppArmor initialized
334Oct 27 20:18:09 localhost kernel: [ 0.024000] Dentry cache hash table entries: 524288 (order: 10, 4194304 bytes)
335Oct 27 20:18:09 localhost kernel: [ 0.024000] Inode-cache hash table entries: 262144 (order: 9, 2097152 bytes)
336Oct 27 20:18:09 localhost kernel: [ 0.024000] Mount-cache hash table entries: 8192 (order: 4, 65536 bytes)
337Oct 27 20:18:09 localhost kernel: [ 0.024000] Mountpoint-cache hash table entries: 8192 (order: 4, 65536 bytes)
338Oct 27 20:18:09 localhost kernel: [ 0.024000] ENERGY_PERF_BIAS: Set to 'normal', was 'performance'
339Oct 27 20:18:09 localhost kernel: [ 0.024000] ENERGY_PERF_BIAS: View and update with x86_energy_perf_policy(8)
340Oct 27 20:18:09 localhost kernel: [ 0.024000] CPU0: Thermal monitoring enabled (TM1)
341Oct 27 20:18:09 localhost kernel: [ 0.024000] process: using mwait in idle threads
342Oct 27 20:18:09 localhost kernel: [ 0.024000] Last level iTLB entries: 4KB 512, 2MB 8, 4MB 8
343Oct 27 20:18:09 localhost kernel: [ 0.024000] Last level dTLB entries: 4KB 512, 2MB 32, 4MB 32, 1GB 0
344Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V1 : Mitigation: usercopy/swapgs barriers and __user pointer sanitization
345Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V2 : Mitigation: Full generic retpoline
346Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V2 : Spectre v2 / SpectreRSB mitigation: Filling RSB on context switch
347Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V2 : Enabling Restricted Speculation for firmware calls
348Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V2 : mitigation: Enabling conditional Indirect Branch Prediction Barrier
349Oct 27 20:18:09 localhost kernel: [ 0.024000] Speculative Store Bypass: Mitigation: Speculative Store Bypass disabled via prctl and seccomp
350Oct 27 20:18:09 localhost kernel: [ 0.024000] MDS: Mitigation: Clear CPU buffers
351Oct 27 20:18:09 localhost kernel: [ 0.024000] Freeing SMP alternatives memory: 36K
352Oct 27 20:18:09 localhost kernel: [ 0.031329] TSC deadline timer enabled
353Oct 27 20:18:09 localhost kernel: [ 0.031332] smpboot: CPU0: Intel(R) Celeron(R) CPU G530 @ 2.40GHz (family: 0x6, model: 0x2a, stepping: 0x7)
354Oct 27 20:18:09 localhost kernel: [ 0.031410] Performance Events: PEBS fmt1+, SandyBridge events, 16-deep LBR, full-width counters, Intel PMU driver.
355Oct 27 20:18:09 localhost kernel: [ 0.031435] ... version: 3
356Oct 27 20:18:09 localhost kernel: [ 0.031435] ... bit width: 48
357Oct 27 20:18:09 localhost kernel: [ 0.031436] ... generic registers: 8
358Oct 27 20:18:09 localhost kernel: [ 0.031437] ... value mask: 0000ffffffffffff
359Oct 27 20:18:09 localhost kernel: [ 0.031437] ... max period: 00007fffffffffff
360Oct 27 20:18:09 localhost kernel: [ 0.031438] ... fixed-purpose events: 3
361Oct 27 20:18:09 localhost kernel: [ 0.031438] ... event mask: 00000007000000ff
362Oct 27 20:18:09 localhost kernel: [ 0.031482] Hierarchical SRCU implementation.
363Oct 27 20:18:09 localhost kernel: [ 0.032000] NMI watchdog: Enabled. Permanently consumes one hw-PMU counter.
364Oct 27 20:18:09 localhost kernel: [ 0.032000] smp: Bringing up secondary CPUs ...
365Oct 27 20:18:09 localhost kernel: [ 0.032000] x86: Booting SMP configuration:
366Oct 27 20:18:09 localhost kernel: [ 0.032000] .... node #0, CPUs: #1
367Oct 27 20:18:09 localhost kernel: [ 0.032028] smp: Brought up 1 node, 2 CPUs
368Oct 27 20:18:09 localhost kernel: [ 0.032028] smpboot: Max logical packages: 1
369Oct 27 20:18:09 localhost kernel: [ 0.032028] smpboot: Total of 2 processors activated (9578.13 BogoMIPS)
370Oct 27 20:18:09 localhost kernel: [ 0.033215] devtmpfs: initialized
371Oct 27 20:18:09 localhost kernel: [ 0.033215] x86/mm: Memory block size: 128MB
372Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.selinux
373Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.SMACK64
374Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.SMACK64EXEC
375Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.SMACK64TRANSMUTE
376Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.SMACK64MMAP
377Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.apparmor
378Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.ima
379Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.capability
380Oct 27 20:18:09 localhost kernel: [ 0.033215] PM: Registering ACPI NVS region [mem 0xdf590000-0xdf5d5fff] (286720 bytes)
381Oct 27 20:18:09 localhost kernel: [ 0.033215] PM: Registering ACPI NVS region [mem 0xdf60d000-0xdf615fff] (36864 bytes)
382Oct 27 20:18:09 localhost kernel: [ 0.033215] PM: Registering ACPI NVS region [mem 0xdf63e000-0xdf680fff] (274432 bytes)
383Oct 27 20:18:09 localhost kernel: [ 0.033215] clocksource: jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 7645041785100000 ns
384Oct 27 20:18:09 localhost kernel: [ 0.033215] futex hash table entries: 512 (order: 3, 32768 bytes)
385Oct 27 20:18:09 localhost kernel: [ 0.033215] pinctrl core: initialized pinctrl subsystem
386Oct 27 20:18:09 localhost kernel: [ 0.033215] RTC time: 19:18:01, date: 10/27/19
387Oct 27 20:18:09 localhost kernel: [ 0.033215] NET: Registered protocol family 16
388Oct 27 20:18:09 localhost kernel: [ 0.033215] audit: initializing netlink subsys (disabled)
389Oct 27 20:18:09 localhost kernel: [ 0.033215] audit: type=2000 audit(1572203881.032:1): state=initialized audit_enabled=0 res=1
390Oct 27 20:18:09 localhost kernel: [ 0.033215] cpuidle: using governor ladder
391Oct 27 20:18:09 localhost kernel: [ 0.033215] cpuidle: using governor menu
392Oct 27 20:18:09 localhost kernel: [ 0.033215] ACPI: bus type PCI registered
393Oct 27 20:18:09 localhost kernel: [ 0.033215] acpiphp: ACPI Hot Plug PCI Controller Driver version: 0.5
394Oct 27 20:18:09 localhost kernel: [ 0.033215] PCI: MMCONFIG for domain 0000 [bus 00-ff] at [mem 0xe0000000-0xefffffff] (base 0xe0000000)
395Oct 27 20:18:09 localhost kernel: [ 0.033215] PCI: not using MMCONFIG
396Oct 27 20:18:09 localhost kernel: [ 0.033215] PCI: Using configuration type 1 for base access
397Oct 27 20:18:09 localhost kernel: [ 0.033215] core: PMU erratum BJ122, BV98, HSD29 workaround disabled, HT off
398Oct 27 20:18:09 localhost kernel: [ 0.033232] HugeTLB registered 2.00 MiB page size, pre-allocated 0 pages
399Oct 27 20:18:09 localhost kernel: [ 0.036082] ACPI: Added _OSI(Module Device)
400Oct 27 20:18:09 localhost kernel: [ 0.036083] ACPI: Added _OSI(Processor Device)
401Oct 27 20:18:09 localhost kernel: [ 0.036084] ACPI: Added _OSI(3.0 _SCP Extensions)
402Oct 27 20:18:09 localhost kernel: [ 0.036084] ACPI: Added _OSI(Processor Aggregator Device)
403Oct 27 20:18:09 localhost kernel: [ 0.036086] ACPI: Added _OSI(Linux-Dell-Video)
404Oct 27 20:18:09 localhost kernel: [ 0.036087] ACPI: Added _OSI(Linux-Lenovo-NV-HDMI-Audio)
405Oct 27 20:18:09 localhost kernel: [ 0.036087] ACPI: Added _OSI(Linux-HPI-Hybrid-Graphics)
406Oct 27 20:18:09 localhost kernel: [ 0.036296] ACPI: Executed 1 blocks of module-level executable AML code
407Oct 27 20:18:09 localhost kernel: [ 0.041863] ACPI: Dynamic OEM Table Load:
408Oct 27 20:18:09 localhost kernel: [ 0.041868] ACPI: SSDT 0xFFFF9E6BD9DA3C00 0001D8 (v01 AMI IST 00000001 MSFT 03000001)
409Oct 27 20:18:09 localhost kernel: [ 0.042080] ACPI: Dynamic OEM Table Load:
410Oct 27 20:18:09 localhost kernel: [ 0.042083] ACPI: SSDT 0xFFFF9E6BD9D4FA80 000054 (v01 AMI CST 00000001 MSFT 03000001)
411Oct 27 20:18:09 localhost kernel: [ 0.043060] ACPI: Interpreter enabled
412Oct 27 20:18:09 localhost kernel: [ 0.043079] ACPI: (supports S0 S1 S3 S4 S5)
413Oct 27 20:18:09 localhost kernel: [ 0.043080] ACPI: Using IOAPIC for interrupt routing
414Oct 27 20:18:09 localhost kernel: [ 0.043115] PCI: MMCONFIG for domain 0000 [bus 00-ff] at [mem 0xe0000000-0xefffffff] (base 0xe0000000)
415Oct 27 20:18:09 localhost kernel: [ 0.043219] PCI: MMCONFIG at [mem 0xe0000000-0xefffffff] reserved in ACPI motherboard resources
416Oct 27 20:18:09 localhost kernel: [ 0.043234] PCI: Using host bridge windows from ACPI; if necessary, use "pci=nocrs" and report a bug
417Oct 27 20:18:09 localhost kernel: [ 0.043662] ACPI: GPE 0x1B active on init
418Oct 27 20:18:09 localhost kernel: [ 0.043677] ACPI: Enabled 8 GPEs in block 00 to 3F
419Oct 27 20:18:09 localhost kernel: [ 0.043939] ACPI: [Firmware Bug]: BIOS _OSI(Linux) query ignored
420Oct 27 20:18:09 localhost kernel: [ 0.053280] ACPI: PCI Root Bridge [PCI0] (domain 0000 [bus 00-ff])
421Oct 27 20:18:09 localhost kernel: [ 0.053285] acpi PNP0A08:00: _OSC: OS supports [ExtendedConfig ASPM ClockPM Segments MSI]
422Oct 27 20:18:09 localhost kernel: [ 0.053528] acpi PNP0A08:00: _OSC: platform does not support [PCIeHotplug]
423Oct 27 20:18:09 localhost kernel: [ 0.053755] acpi PNP0A08:00: _OSC: OS now controls [PME AER PCIeCapability]
424Oct 27 20:18:09 localhost kernel: [ 0.054170] PCI host bridge to bus 0000:00
425Oct 27 20:18:09 localhost kernel: [ 0.054173] pci_bus 0000:00: root bus resource [io 0x0000-0x03af window]
426Oct 27 20:18:09 localhost kernel: [ 0.054174] pci_bus 0000:00: root bus resource [io 0x03e0-0x0cf7 window]
427Oct 27 20:18:09 localhost kernel: [ 0.054175] pci_bus 0000:00: root bus resource [io 0x03b0-0x03df window]
428Oct 27 20:18:09 localhost kernel: [ 0.054176] pci_bus 0000:00: root bus resource [io 0x0d00-0xffff window]
429Oct 27 20:18:09 localhost kernel: [ 0.054178] pci_bus 0000:00: root bus resource [mem 0x000a0000-0x000bffff window]
430Oct 27 20:18:09 localhost kernel: [ 0.054179] pci_bus 0000:00: root bus resource [mem 0x000c0000-0x000dffff window]
431Oct 27 20:18:09 localhost kernel: [ 0.054180] pci_bus 0000:00: root bus resource [mem 0xf0000000-0xffffffff window]
432Oct 27 20:18:09 localhost kernel: [ 0.054181] pci_bus 0000:00: root bus resource [bus 00-ff]
433Oct 27 20:18:09 localhost kernel: [ 0.054189] pci 0000:00:00.0: [8086:0100] type 00 class 0x060000
434Oct 27 20:18:09 localhost kernel: [ 0.054291] pci 0000:00:01.0: [8086:0101] type 01 class 0x060400
435Oct 27 20:18:09 localhost kernel: [ 0.054328] pci 0000:00:01.0: PME# supported from D0 D3hot D3cold
436Oct 27 20:18:09 localhost kernel: [ 0.054459] pci 0000:00:16.0: [8086:1c3a] type 00 class 0x078000
437Oct 27 20:18:09 localhost kernel: [ 0.054496] pci 0000:00:16.0: reg 0x10: [mem 0xfb308000-0xfb30800f 64bit]
438Oct 27 20:18:09 localhost kernel: [ 0.054604] pci 0000:00:16.0: PME# supported from D0 D3hot D3cold
439Oct 27 20:18:09 localhost kernel: [ 0.054707] pci 0000:00:1a.0: [8086:1c2d] type 00 class 0x0c0320
440Oct 27 20:18:09 localhost kernel: [ 0.054739] pci 0000:00:1a.0: reg 0x10: [mem 0xfb307000-0xfb3073ff]
441Oct 27 20:18:09 localhost kernel: [ 0.054864] pci 0000:00:1a.0: PME# supported from D0 D3hot D3cold
442Oct 27 20:18:09 localhost kernel: [ 0.054958] pci 0000:00:1b.0: [8086:1c20] type 00 class 0x040300
443Oct 27 20:18:09 localhost kernel: [ 0.054990] pci 0000:00:1b.0: reg 0x10: [mem 0xfb300000-0xfb303fff 64bit]
444Oct 27 20:18:09 localhost kernel: [ 0.055104] pci 0000:00:1b.0: PME# supported from D0 D3hot D3cold
445Oct 27 20:18:09 localhost kernel: [ 0.055199] pci 0000:00:1c.0: [8086:1c10] type 01 class 0x060400
446Oct 27 20:18:09 localhost kernel: [ 0.055325] pci 0000:00:1c.0: PME# supported from D0 D3hot D3cold
447Oct 27 20:18:09 localhost kernel: [ 0.055428] pci 0000:00:1c.1: [8086:244e] type 01 class 0x060401
448Oct 27 20:18:09 localhost kernel: [ 0.055554] pci 0000:00:1c.1: PME# supported from D0 D3hot D3cold
449Oct 27 20:18:09 localhost kernel: [ 0.055654] pci 0000:00:1c.2: [8086:1c14] type 01 class 0x060400
450Oct 27 20:18:09 localhost kernel: [ 0.055779] pci 0000:00:1c.2: PME# supported from D0 D3hot D3cold
451Oct 27 20:18:09 localhost kernel: [ 0.055887] pci 0000:00:1d.0: [8086:1c26] type 00 class 0x0c0320
452Oct 27 20:18:09 localhost kernel: [ 0.055918] pci 0000:00:1d.0: reg 0x10: [mem 0xfb306000-0xfb3063ff]
453Oct 27 20:18:09 localhost kernel: [ 0.056044] pci 0000:00:1d.0: PME# supported from D0 D3hot D3cold
454Oct 27 20:18:09 localhost kernel: [ 0.056137] pci 0000:00:1f.0: [8086:1c5c] type 00 class 0x060100
455Oct 27 20:18:09 localhost kernel: [ 0.056374] pci 0000:00:1f.2: [8086:1c02] type 00 class 0x010601
456Oct 27 20:18:09 localhost kernel: [ 0.056403] pci 0000:00:1f.2: reg 0x10: [io 0xf070-0xf077]
457Oct 27 20:18:09 localhost kernel: [ 0.056414] pci 0000:00:1f.2: reg 0x14: [io 0xf060-0xf063]
458Oct 27 20:18:09 localhost kernel: [ 0.056425] pci 0000:00:1f.2: reg 0x18: [io 0xf050-0xf057]
459Oct 27 20:18:09 localhost kernel: [ 0.056437] pci 0000:00:1f.2: reg 0x1c: [io 0xf040-0xf043]
460Oct 27 20:18:09 localhost kernel: [ 0.056447] pci 0000:00:1f.2: reg 0x20: [io 0xf020-0xf03f]
461Oct 27 20:18:09 localhost kernel: [ 0.056458] pci 0000:00:1f.2: reg 0x24: [mem 0xfb305000-0xfb3057ff]
462Oct 27 20:18:09 localhost kernel: [ 0.056524] pci 0000:00:1f.2: PME# supported from D3hot
463Oct 27 20:18:09 localhost kernel: [ 0.056609] pci 0000:00:1f.3: [8086:1c22] type 00 class 0x0c0500
464Oct 27 20:18:09 localhost kernel: [ 0.056637] pci 0000:00:1f.3: reg 0x10: [mem 0xfb304000-0xfb3040ff 64bit]
465Oct 27 20:18:09 localhost kernel: [ 0.056669] pci 0000:00:1f.3: reg 0x20: [io 0xf000-0xf01f]
466Oct 27 20:18:09 localhost kernel: [ 0.056808] pci 0000:01:00.0: [10de:1040] type 00 class 0x030000
467Oct 27 20:18:09 localhost kernel: [ 0.056823] pci 0000:01:00.0: reg 0x10: [mem 0xfa000000-0xfaffffff]
468Oct 27 20:18:09 localhost kernel: [ 0.056832] pci 0000:01:00.0: reg 0x14: [mem 0xf0000000-0xf7ffffff 64bit pref]
469Oct 27 20:18:09 localhost kernel: [ 0.056841] pci 0000:01:00.0: reg 0x1c: [mem 0xf8000000-0xf9ffffff 64bit pref]
470Oct 27 20:18:09 localhost kernel: [ 0.056847] pci 0000:01:00.0: reg 0x24: [io 0xe000-0xe07f]
471Oct 27 20:18:09 localhost kernel: [ 0.056853] pci 0000:01:00.0: reg 0x30: [mem 0xfb000000-0xfb07ffff pref]
472Oct 27 20:18:09 localhost kernel: [ 0.056859] pci 0000:01:00.0: enabling Extended Tags
473Oct 27 20:18:09 localhost kernel: [ 0.056936] pci 0000:01:00.1: [10de:0e08] type 00 class 0x040300
474Oct 27 20:18:09 localhost kernel: [ 0.056949] pci 0000:01:00.1: reg 0x10: [mem 0xfb080000-0xfb083fff]
475Oct 27 20:18:09 localhost kernel: [ 0.056983] pci 0000:01:00.1: enabling Extended Tags
476Oct 27 20:18:09 localhost kernel: [ 0.057056] pci 0000:00:01.0: PCI bridge to [bus 01]
477Oct 27 20:18:09 localhost kernel: [ 0.057059] pci 0000:00:01.0: bridge window [io 0xe000-0xefff]
478Oct 27 20:18:09 localhost kernel: [ 0.057061] pci 0000:00:01.0: bridge window [mem 0xfa000000-0xfb0fffff]
479Oct 27 20:18:09 localhost kernel: [ 0.057063] pci 0000:00:01.0: bridge window [mem 0xf0000000-0xf9ffffff 64bit pref]
480Oct 27 20:18:09 localhost kernel: [ 0.057117] pci 0000:00:1c.0: PCI bridge to [bus 02]
481Oct 27 20:18:09 localhost kernel: [ 0.057214] pci 0000:03:00.0: [1b21:1080] type 01 class 0x060401
482Oct 27 20:18:09 localhost kernel: [ 0.057402] pci 0000:00:1c.1: PCI bridge to [bus 03-04] (subtractive decode)
483Oct 27 20:18:09 localhost kernel: [ 0.057410] pci 0000:00:1c.1: bridge window [mem 0xfb200000-0xfb2fffff]
484Oct 27 20:18:09 localhost kernel: [ 0.057417] pci 0000:00:1c.1: bridge window [io 0x0000-0x03af window] (subtractive decode)
485Oct 27 20:18:09 localhost kernel: [ 0.057419] pci 0000:00:1c.1: bridge window [io 0x03e0-0x0cf7 window] (subtractive decode)
486Oct 27 20:18:09 localhost kernel: [ 0.057420] pci 0000:00:1c.1: bridge window [io 0x03b0-0x03df window] (subtractive decode)
487Oct 27 20:18:09 localhost kernel: [ 0.057421] pci 0000:00:1c.1: bridge window [io 0x0d00-0xffff window] (subtractive decode)
488Oct 27 20:18:09 localhost kernel: [ 0.057422] pci 0000:00:1c.1: bridge window [mem 0x000a0000-0x000bffff window] (subtractive decode)
489Oct 27 20:18:09 localhost kernel: [ 0.057423] pci 0000:00:1c.1: bridge window [mem 0x000c0000-0x000dffff window] (subtractive decode)
490Oct 27 20:18:09 localhost kernel: [ 0.057425] pci 0000:00:1c.1: bridge window [mem 0xf0000000-0xffffffff window] (subtractive decode)
491Oct 27 20:18:09 localhost kernel: [ 0.057481] pci 0000:04:00.0: [1131:7146] type 00 class 0x048000
492Oct 27 20:18:09 localhost kernel: [ 0.057522] pci 0000:04:00.0: reg 0x10: [mem 0xfb201000-0xfb2011ff]
493Oct 27 20:18:09 localhost kernel: [ 0.057704] pci 0000:04:01.0: [1131:7146] type 00 class 0x048000
494Oct 27 20:18:09 localhost kernel: [ 0.057744] pci 0000:04:01.0: reg 0x10: [mem 0xfb200000-0xfb2001ff]
495Oct 27 20:18:09 localhost kernel: [ 0.057998] pci 0000:03:00.0: PCI bridge to [bus 04] (subtractive decode)
496Oct 27 20:18:09 localhost kernel: [ 0.058015] pci 0000:03:00.0: bridge window [mem 0xfb200000-0xfb2fffff]
497Oct 27 20:18:09 localhost kernel: [ 0.058027] pci 0000:03:00.0: bridge window [mem 0xfb200000-0xfb2fffff] (subtractive decode)
498Oct 27 20:18:09 localhost kernel: [ 0.058028] pci 0000:03:00.0: bridge window [io 0x0000-0x03af window] (subtractive decode)
499Oct 27 20:18:09 localhost kernel: [ 0.058029] pci 0000:03:00.0: bridge window [io 0x03e0-0x0cf7 window] (subtractive decode)
500Oct 27 20:18:09 localhost kernel: [ 0.058030] pci 0000:03:00.0: bridge window [io 0x03b0-0x03df window] (subtractive decode)
501Oct 27 20:18:09 localhost kernel: [ 0.058031] pci 0000:03:00.0: bridge window [io 0x0d00-0xffff window] (subtractive decode)
502Oct 27 20:18:09 localhost kernel: [ 0.058033] pci 0000:03:00.0: bridge window [mem 0x000a0000-0x000bffff window] (subtractive decode)
503Oct 27 20:18:09 localhost kernel: [ 0.058034] pci 0000:03:00.0: bridge window [mem 0x000c0000-0x000dffff window] (subtractive decode)
504Oct 27 20:18:09 localhost kernel: [ 0.058035] pci 0000:03:00.0: bridge window [mem 0xf0000000-0xffffffff window] (subtractive decode)
505Oct 27 20:18:09 localhost kernel: [ 0.058125] pci 0000:05:00.0: [1969:1083] type 00 class 0x020000
506Oct 27 20:18:09 localhost kernel: [ 0.058178] pci 0000:05:00.0: reg 0x10: [mem 0xfb100000-0xfb13ffff 64bit]
507Oct 27 20:18:09 localhost kernel: [ 0.058196] pci 0000:05:00.0: reg 0x18: [io 0xd000-0xd07f]
508Oct 27 20:18:09 localhost kernel: [ 0.058372] pci 0000:05:00.0: PME# supported from D0 D1 D2 D3hot D3cold
509Oct 27 20:18:09 localhost kernel: [ 0.068032] pci 0000:00:1c.2: PCI bridge to [bus 05]
510Oct 27 20:18:09 localhost kernel: [ 0.068037] pci 0000:00:1c.2: bridge window [io 0xd000-0xdfff]
511Oct 27 20:18:09 localhost kernel: [ 0.068042] pci 0000:00:1c.2: bridge window [mem 0xfb100000-0xfb1fffff]
512Oct 27 20:18:09 localhost kernel: [ 0.069034] ACPI: PCI Interrupt Link [LNKA] (IRQs 3 4 5 6 7 10 *11 12 14 15)
513Oct 27 20:18:09 localhost kernel: [ 0.069115] ACPI: PCI Interrupt Link [LNKB] (IRQs 3 4 5 6 7 *10 11 12 14 15)
514Oct 27 20:18:09 localhost kernel: [ 0.069191] ACPI: PCI Interrupt Link [LNKC] (IRQs *3 4 5 6 10 11 12 14 15)
515Oct 27 20:18:09 localhost kernel: [ 0.069266] ACPI: PCI Interrupt Link [LNKD] (IRQs *3 4 5 6 10 11 12 14 15)
516Oct 27 20:18:09 localhost kernel: [ 0.069341] ACPI: PCI Interrupt Link [LNKE] (IRQs 3 4 5 6 7 10 11 12 14 15) *0
517Oct 27 20:18:09 localhost kernel: [ 0.069417] ACPI: PCI Interrupt Link [LNKF] (IRQs 3 4 5 6 7 10 11 12 14 15) *0
518Oct 27 20:18:09 localhost kernel: [ 0.069492] ACPI: PCI Interrupt Link [LNKG] (IRQs *3 4 5 6 7 10 11 12 14 15)
519Oct 27 20:18:09 localhost kernel: [ 0.069568] ACPI: PCI Interrupt Link [LNKH] (IRQs *3 4 5 6 7 10 11 12 14 15)
520Oct 27 20:18:09 localhost kernel: [ 0.069871] SCSI subsystem initialized
521Oct 27 20:18:09 localhost kernel: [ 0.069910] libata version 3.00 loaded.
522Oct 27 20:18:09 localhost kernel: [ 0.069910] pci 0000:01:00.0: vgaarb: setting as boot VGA device
523Oct 27 20:18:09 localhost kernel: [ 0.069910] pci 0000:01:00.0: vgaarb: VGA device added: decodes=io+mem,owns=io+mem,locks=none
524Oct 27 20:18:09 localhost kernel: [ 0.069910] pci 0000:01:00.0: vgaarb: bridge control possible
525Oct 27 20:18:09 localhost kernel: [ 0.069910] vgaarb: loaded
526Oct 27 20:18:09 localhost kernel: [ 0.069910] ACPI: bus type USB registered
527Oct 27 20:18:09 localhost kernel: [ 0.069910] usbcore: registered new interface driver usbfs
528Oct 27 20:18:09 localhost kernel: [ 0.069910] usbcore: registered new interface driver hub
529Oct 27 20:18:09 localhost kernel: [ 0.069910] usbcore: registered new device driver usb
530Oct 27 20:18:09 localhost kernel: [ 0.069910] EDAC MC: Ver: 3.0.0
531Oct 27 20:18:09 localhost kernel: [ 0.069910] PCI: Using ACPI for IRQ routing
532Oct 27 20:18:09 localhost kernel: [ 0.081129] PCI: pci_cache_line_size set to 64 bytes
533Oct 27 20:18:09 localhost kernel: [ 0.081196] e820: reserve RAM buffer [mem 0x0009d800-0x0009ffff]
534Oct 27 20:18:09 localhost kernel: [ 0.081197] e820: reserve RAM buffer [mem 0xdf590000-0xdfffffff]
535Oct 27 20:18:09 localhost kernel: [ 0.081199] e820: reserve RAM buffer [mem 0xdf60c000-0xdfffffff]
536Oct 27 20:18:09 localhost kernel: [ 0.081200] e820: reserve RAM buffer [mem 0xdf800000-0xdfffffff]
537Oct 27 20:18:09 localhost kernel: [ 0.081201] e820: reserve RAM buffer [mem 0x11f800000-0x11fffffff]
538Oct 27 20:18:09 localhost kernel: [ 0.081295] NetLabel: Initializing
539Oct 27 20:18:09 localhost kernel: [ 0.081296] NetLabel: domain hash size = 128
540Oct 27 20:18:09 localhost kernel: [ 0.081297] NetLabel: protocols = UNLABELED CIPSOv4 CALIPSO
541Oct 27 20:18:09 localhost kernel: [ 0.081314] NetLabel: unlabeled traffic allowed by default
542Oct 27 20:18:09 localhost kernel: [ 0.081330] hpet0: at MMIO 0xfed00000, IRQs 2, 8, 0, 0, 0, 0, 0, 0
543Oct 27 20:18:09 localhost kernel: [ 0.081330] hpet0: 8 comparators, 64-bit 14.318180 MHz counter
544Oct 27 20:18:09 localhost kernel: [ 0.082599] clocksource: Switched to clocksource hpet
545Oct 27 20:18:09 localhost kernel: [ 0.091757] VFS: Disk quotas dquot_6.6.0
546Oct 27 20:18:09 localhost kernel: [ 0.091775] VFS: Dquot-cache hash table entries: 512 (order 0, 4096 bytes)
547Oct 27 20:18:09 localhost kernel: [ 0.091877] AppArmor: AppArmor Filesystem Enabled
548Oct 27 20:18:09 localhost kernel: [ 0.091907] pnp: PnP ACPI init
549Oct 27 20:18:09 localhost kernel: [ 0.092134] system 00:00: [mem 0xfed10000-0xfed19fff] has been reserved
550Oct 27 20:18:09 localhost kernel: [ 0.092135] system 00:00: [mem 0xe0000000-0xefffffff] has been reserved
551Oct 27 20:18:09 localhost kernel: [ 0.092137] system 00:00: [mem 0xfed90000-0xfed93fff] has been reserved
552Oct 27 20:18:09 localhost kernel: [ 0.092138] system 00:00: [mem 0xfed20000-0xfed3ffff] has been reserved
553Oct 27 20:18:09 localhost kernel: [ 0.092139] system 00:00: [mem 0xfee00000-0xfee0ffff] has been reserved
554Oct 27 20:18:09 localhost kernel: [ 0.092145] system 00:00: Plug and Play ACPI device, IDs PNP0c01 (active)
555Oct 27 20:18:09 localhost kernel: [ 0.092264] system 00:01: [io 0x0290-0x029f] has been reserved
556Oct 27 20:18:09 localhost kernel: [ 0.092268] system 00:01: Plug and Play ACPI device, IDs PNP0c02 (active)
557Oct 27 20:18:09 localhost kernel: [ 0.092723] pnp 00:02: [dma 3]
558Oct 27 20:18:09 localhost kernel: [ 0.092867] pnp 00:02: Plug and Play ACPI device, IDs PNP0401 (active)
559Oct 27 20:18:09 localhost kernel: [ 0.093005] pnp 00:03: Plug and Play ACPI device, IDs NTN0530 (active)
560Oct 27 20:18:09 localhost kernel: [ 0.093032] pnp 00:04: Plug and Play ACPI device, IDs PNP0b00 (active)
561Oct 27 20:18:09 localhost kernel: [ 0.093098] system 00:05: [io 0x04d0-0x04d1] has been reserved
562Oct 27 20:18:09 localhost kernel: [ 0.093103] system 00:05: Plug and Play ACPI device, IDs PNP0c02 (active)
563Oct 27 20:18:09 localhost kernel: [ 0.093428] pnp 00:06: [dma 0 disabled]
564Oct 27 20:18:09 localhost kernel: [ 0.093476] pnp 00:06: Plug and Play ACPI device, IDs PNP0501 (active)
565Oct 27 20:18:09 localhost kernel: [ 0.093901] system 00:07: [io 0x0400-0x0453] has been reserved
566Oct 27 20:18:09 localhost kernel: [ 0.093903] system 00:07: [io 0x0458-0x047f] has been reserved
567Oct 27 20:18:09 localhost kernel: [ 0.093905] system 00:07: [io 0x1180-0x119f] has been reserved
568Oct 27 20:18:09 localhost kernel: [ 0.093906] system 00:07: [io 0x0500-0x057f] has been reserved
569Oct 27 20:18:09 localhost kernel: [ 0.093908] system 00:07: [mem 0xfed1c000-0xfed1ffff] has been reserved
570Oct 27 20:18:09 localhost kernel: [ 0.093910] system 00:07: [mem 0xfec00000-0xfecfffff] could not be reserved
571Oct 27 20:18:09 localhost kernel: [ 0.093911] system 00:07: [mem 0xfed08000-0xfed08fff] has been reserved
572Oct 27 20:18:09 localhost kernel: [ 0.093913] system 00:07: [mem 0xff000000-0xffffffff] has been reserved
573Oct 27 20:18:09 localhost kernel: [ 0.093917] system 00:07: Plug and Play ACPI device, IDs PNP0c01 (active)
574Oct 27 20:18:09 localhost kernel: [ 0.093998] system 00:08: [io 0x0454-0x0457] has been reserved
575Oct 27 20:18:09 localhost kernel: [ 0.094002] system 00:08: Plug and Play ACPI device, IDs INT3f0d PNP0c02 (active)
576Oct 27 20:18:09 localhost kernel: [ 0.094291] pnp: PnP ACPI: found 9 devices
577Oct 27 20:18:09 localhost kernel: [ 0.100766] clocksource: acpi_pm: mask: 0xffffff max_cycles: 0xffffff, max_idle_ns: 2085701024 ns
578Oct 27 20:18:09 localhost kernel: [ 0.100826] pci 0000:00:01.0: PCI bridge to [bus 01]
579Oct 27 20:18:09 localhost kernel: [ 0.100828] pci 0000:00:01.0: bridge window [io 0xe000-0xefff]
580Oct 27 20:18:09 localhost kernel: [ 0.100831] pci 0000:00:01.0: bridge window [mem 0xfa000000-0xfb0fffff]
581Oct 27 20:18:09 localhost kernel: [ 0.100833] pci 0000:00:01.0: bridge window [mem 0xf0000000-0xf9ffffff 64bit pref]
582Oct 27 20:18:09 localhost kernel: [ 0.100836] pci 0000:00:1c.0: PCI bridge to [bus 02]
583Oct 27 20:18:09 localhost kernel: [ 0.100852] pci 0000:03:00.0: PCI bridge to [bus 04]
584Oct 27 20:18:09 localhost kernel: [ 0.100860] pci 0000:03:00.0: bridge window [mem 0xfb200000-0xfb2fffff]
585Oct 27 20:18:09 localhost kernel: [ 0.100877] pci 0000:00:1c.1: PCI bridge to [bus 03-04]
586Oct 27 20:18:09 localhost kernel: [ 0.100883] pci 0000:00:1c.1: bridge window [mem 0xfb200000-0xfb2fffff]
587Oct 27 20:18:09 localhost kernel: [ 0.100894] pci 0000:00:1c.2: PCI bridge to [bus 05]
588Oct 27 20:18:09 localhost kernel: [ 0.100896] pci 0000:00:1c.2: bridge window [io 0xd000-0xdfff]
589Oct 27 20:18:09 localhost kernel: [ 0.100902] pci 0000:00:1c.2: bridge window [mem 0xfb100000-0xfb1fffff]
590Oct 27 20:18:09 localhost kernel: [ 0.100914] pci_bus 0000:00: resource 4 [io 0x0000-0x03af window]
591Oct 27 20:18:09 localhost kernel: [ 0.100915] pci_bus 0000:00: resource 5 [io 0x03e0-0x0cf7 window]
592Oct 27 20:18:09 localhost kernel: [ 0.100916] pci_bus 0000:00: resource 6 [io 0x03b0-0x03df window]
593Oct 27 20:18:09 localhost kernel: [ 0.100917] pci_bus 0000:00: resource 7 [io 0x0d00-0xffff window]
594Oct 27 20:18:09 localhost kernel: [ 0.100919] pci_bus 0000:00: resource 8 [mem 0x000a0000-0x000bffff window]
595Oct 27 20:18:09 localhost kernel: [ 0.100920] pci_bus 0000:00: resource 9 [mem 0x000c0000-0x000dffff window]
596Oct 27 20:18:09 localhost kernel: [ 0.100921] pci_bus 0000:00: resource 10 [mem 0xf0000000-0xffffffff window]
597Oct 27 20:18:09 localhost kernel: [ 0.100922] pci_bus 0000:01: resource 0 [io 0xe000-0xefff]
598Oct 27 20:18:09 localhost kernel: [ 0.100924] pci_bus 0000:01: resource 1 [mem 0xfa000000-0xfb0fffff]
599Oct 27 20:18:09 localhost kernel: [ 0.100925] pci_bus 0000:01: resource 2 [mem 0xf0000000-0xf9ffffff 64bit pref]
600Oct 27 20:18:09 localhost kernel: [ 0.100926] pci_bus 0000:03: resource 1 [mem 0xfb200000-0xfb2fffff]
601Oct 27 20:18:09 localhost kernel: [ 0.100927] pci_bus 0000:03: resource 4 [io 0x0000-0x03af window]
602Oct 27 20:18:09 localhost kernel: [ 0.100929] pci_bus 0000:03: resource 5 [io 0x03e0-0x0cf7 window]
603Oct 27 20:18:09 localhost kernel: [ 0.100930] pci_bus 0000:03: resource 6 [io 0x03b0-0x03df window]
604Oct 27 20:18:09 localhost kernel: [ 0.100931] pci_bus 0000:03: resource 7 [io 0x0d00-0xffff window]
605Oct 27 20:18:09 localhost kernel: [ 0.100932] pci_bus 0000:03: resource 8 [mem 0x000a0000-0x000bffff window]
606Oct 27 20:18:09 localhost kernel: [ 0.100933] pci_bus 0000:03: resource 9 [mem 0x000c0000-0x000dffff window]
607Oct 27 20:18:09 localhost kernel: [ 0.100934] pci_bus 0000:03: resource 10 [mem 0xf0000000-0xffffffff window]
608Oct 27 20:18:09 localhost kernel: [ 0.100936] pci_bus 0000:04: resource 1 [mem 0xfb200000-0xfb2fffff]
609Oct 27 20:18:09 localhost kernel: [ 0.100937] pci_bus 0000:04: resource 4 [mem 0xfb200000-0xfb2fffff]
610Oct 27 20:18:09 localhost kernel: [ 0.100938] pci_bus 0000:04: resource 5 [io 0x0000-0x03af window]
611Oct 27 20:18:09 localhost kernel: [ 0.100939] pci_bus 0000:04: resource 6 [io 0x03e0-0x0cf7 window]
612Oct 27 20:18:09 localhost kernel: [ 0.100940] pci_bus 0000:04: resource 7 [io 0x03b0-0x03df window]
613Oct 27 20:18:09 localhost kernel: [ 0.100941] pci_bus 0000:04: resource 8 [io 0x0d00-0xffff window]
614Oct 27 20:18:09 localhost kernel: [ 0.100942] pci_bus 0000:04: resource 9 [mem 0x000a0000-0x000bffff window]
615Oct 27 20:18:09 localhost kernel: [ 0.100944] pci_bus 0000:04: resource 10 [mem 0x000c0000-0x000dffff window]
616Oct 27 20:18:09 localhost kernel: [ 0.100945] pci_bus 0000:04: resource 11 [mem 0xf0000000-0xffffffff window]
617Oct 27 20:18:09 localhost kernel: [ 0.100946] pci_bus 0000:05: resource 0 [io 0xd000-0xdfff]
618Oct 27 20:18:09 localhost kernel: [ 0.100947] pci_bus 0000:05: resource 1 [mem 0xfb100000-0xfb1fffff]
619Oct 27 20:18:09 localhost kernel: [ 0.101048] NET: Registered protocol family 2
620Oct 27 20:18:09 localhost kernel: [ 0.101218] TCP established hash table entries: 32768 (order: 6, 262144 bytes)
621Oct 27 20:18:09 localhost kernel: [ 0.101292] TCP bind hash table entries: 32768 (order: 7, 524288 bytes)
622Oct 27 20:18:09 localhost kernel: [ 0.101395] TCP: Hash tables configured (established 32768 bind 32768)
623Oct 27 20:18:09 localhost kernel: [ 0.101427] UDP hash table entries: 2048 (order: 4, 65536 bytes)
624Oct 27 20:18:09 localhost kernel: [ 0.101445] UDP-Lite hash table entries: 2048 (order: 4, 65536 bytes)
625Oct 27 20:18:09 localhost kernel: [ 0.101491] NET: Registered protocol family 1
626Oct 27 20:18:09 localhost kernel: [ 0.160123] pci 0000:01:00.0: Video device with shadowed ROM at [mem 0x000c0000-0x000dffff]
627Oct 27 20:18:09 localhost kernel: [ 0.160143] pci 0000:05:00.0: [Firmware Bug]: disabling VPD access (can't determine size of non-standard VPD format)
628Oct 27 20:18:09 localhost kernel: [ 0.160147] PCI: CLS 64 bytes, default 64
629Oct 27 20:18:09 localhost kernel: [ 0.160194] Unpacking initramfs...
630Oct 27 20:18:09 localhost kernel: [ 1.210361] Freeing initrd memory: 68684K
631Oct 27 20:18:09 localhost kernel: [ 1.210365] PCI-DMA: Using software bounce buffering for IO (SWIOTLB)
632Oct 27 20:18:09 localhost kernel: [ 1.210366] software IO TLB: mapped [mem 0xdb590000-0xdf590000] (64MB)
633Oct 27 20:18:09 localhost kernel: [ 1.210630] Scanning for low memory corruption every 60 seconds
634Oct 27 20:18:09 localhost kernel: [ 1.211290] Initialise system trusted keyrings
635Oct 27 20:18:09 localhost kernel: [ 1.211301] Key type blacklist registered
636Oct 27 20:18:09 localhost kernel: [ 1.211331] workingset: timestamp_bits=36 max_order=20 bucket_order=0
637Oct 27 20:18:09 localhost kernel: [ 1.212492] zbud: loaded
638Oct 27 20:18:09 localhost kernel: [ 1.212991] squashfs: version 4.0 (2009/01/31) Phillip Lougher
639Oct 27 20:18:09 localhost kernel: [ 1.213136] fuse init (API version 7.26)
640Oct 27 20:18:09 localhost kernel: [ 1.214580] Key type asymmetric registered
641Oct 27 20:18:09 localhost kernel: [ 1.214582] Asymmetric key parser 'x509' registered
642Oct 27 20:18:09 localhost kernel: [ 1.214613] Block layer SCSI generic (bsg) driver version 0.4 loaded (major 246)
643Oct 27 20:18:09 localhost kernel: [ 1.214644] io scheduler noop registered
644Oct 27 20:18:09 localhost kernel: [ 1.214645] io scheduler deadline registered
645Oct 27 20:18:09 localhost kernel: [ 1.214670] io scheduler cfq registered (default)
646Oct 27 20:18:09 localhost kernel: [ 1.215328] pcieport 0000:00:01.0: Signaling PME with IRQ 24
647Oct 27 20:18:09 localhost kernel: [ 1.215363] pcieport 0000:00:1c.0: Signaling PME with IRQ 25
648Oct 27 20:18:09 localhost kernel: [ 1.215390] pcieport 0000:00:1c.2: Signaling PME with IRQ 26
649Oct 27 20:18:09 localhost kernel: [ 1.215456] vesafb: mode is 640x480x32, linelength=2560, pages=0
650Oct 27 20:18:09 localhost kernel: [ 1.215457] vesafb: scrolling: redraw
651Oct 27 20:18:09 localhost kernel: [ 1.215458] vesafb: Truecolor: size=8:8:8:8, shift=24:16:8:0
652Oct 27 20:18:09 localhost kernel: [ 1.215470] vesafb: framebuffer at 0xf9000000, mapped to 0x (ptrval), using 1216k, total 1216k
653Oct 27 20:18:09 localhost kernel: [ 1.215563] Console: switching to colour frame buffer device 80x30
654Oct 27 20:18:09 localhost kernel: [ 1.215574] fb0: VESA VGA frame buffer device
655Oct 27 20:18:09 localhost kernel: [ 1.215589] intel_idle: MWAIT substates: 0x1120
656Oct 27 20:18:09 localhost kernel: [ 1.215590] intel_idle: v0.4.1 model 0x2A
657Oct 27 20:18:09 localhost kernel: [ 1.215654] intel_idle: lapic_timer_reliable_states 0xffffffff
658Oct 27 20:18:09 localhost kernel: [ 1.215744] input: Power Button as /devices/LNXSYSTM:00/LNXSYBUS:00/PNP0C0C:00/input/input0
659Oct 27 20:18:09 localhost kernel: [ 1.215753] ACPI: Power Button [PWRB]
660Oct 27 20:18:09 localhost kernel: [ 1.215788] input: Power Button as /devices/LNXSYSTM:00/LNXPWRBN:00/input/input1
661Oct 27 20:18:09 localhost kernel: [ 1.215816] ACPI: Power Button [PWRF]
662Oct 27 20:18:09 localhost kernel: [ 1.216312] Serial: 8250/16550 driver, 32 ports, IRQ sharing enabled
663Oct 27 20:18:09 localhost kernel: [ 1.237066] 00:06: ttyS0 at I/O 0x3f8 (irq = 4, base_baud = 115200) is a 16550A
664Oct 27 20:18:09 localhost kernel: [ 1.239230] Linux agpgart interface v0.103
665Oct 27 20:18:09 localhost kernel: [ 1.240539] loop: module loaded
666Oct 27 20:18:09 localhost kernel: [ 1.240717] libphy: Fixed MDIO Bus: probed
667Oct 27 20:18:09 localhost kernel: [ 1.240718] tun: Universal TUN/TAP device driver, 1.6
668Oct 27 20:18:09 localhost kernel: [ 1.240754] PPP generic driver version 2.4.2
669Oct 27 20:18:09 localhost kernel: [ 1.240796] ehci_hcd: USB 2.0 'Enhanced' Host Controller (EHCI) Driver
670Oct 27 20:18:09 localhost kernel: [ 1.240798] ehci-pci: EHCI PCI platform driver
671Oct 27 20:18:09 localhost kernel: [ 1.240926] ehci-pci 0000:00:1a.0: EHCI Host Controller
672Oct 27 20:18:09 localhost kernel: [ 1.240932] ehci-pci 0000:00:1a.0: new USB bus registered, assigned bus number 1
673Oct 27 20:18:09 localhost kernel: [ 1.240948] ehci-pci 0000:00:1a.0: debug port 2
674Oct 27 20:18:09 localhost kernel: [ 1.244873] ehci-pci 0000:00:1a.0: cache line size of 64 is not supported
675Oct 27 20:18:09 localhost kernel: [ 1.244887] ehci-pci 0000:00:1a.0: irq 16, io mem 0xfb307000
676Oct 27 20:18:09 localhost kernel: [ 1.260035] ehci-pci 0000:00:1a.0: USB 2.0 started, EHCI 1.00
677Oct 27 20:18:09 localhost kernel: [ 1.260102] usb usb1: New USB device found, idVendor=1d6b, idProduct=0002
678Oct 27 20:18:09 localhost kernel: [ 1.260103] usb usb1: New USB device strings: Mfr=3, Product=2, SerialNumber=1
679Oct 27 20:18:09 localhost kernel: [ 1.260104] usb usb1: Product: EHCI Host Controller
680Oct 27 20:18:09 localhost kernel: [ 1.260106] usb usb1: Manufacturer: Linux 4.15.0-66-generic ehci_hcd
681Oct 27 20:18:09 localhost kernel: [ 1.260107] usb usb1: SerialNumber: 0000:00:1a.0
682Oct 27 20:18:09 localhost kernel: [ 1.260295] hub 1-0:1.0: USB hub found
683Oct 27 20:18:09 localhost kernel: [ 1.260303] hub 1-0:1.0: 2 ports detected
684Oct 27 20:18:09 localhost kernel: [ 1.260518] ehci-pci 0000:00:1d.0: EHCI Host Controller
685Oct 27 20:18:09 localhost kernel: [ 1.260525] ehci-pci 0000:00:1d.0: new USB bus registered, assigned bus number 2
686Oct 27 20:18:09 localhost kernel: [ 1.260539] ehci-pci 0000:00:1d.0: debug port 2
687Oct 27 20:18:09 localhost kernel: [ 1.264437] ehci-pci 0000:00:1d.0: cache line size of 64 is not supported
688Oct 27 20:18:09 localhost kernel: [ 1.264449] ehci-pci 0000:00:1d.0: irq 23, io mem 0xfb306000
689Oct 27 20:18:09 localhost kernel: [ 1.280043] ehci-pci 0000:00:1d.0: USB 2.0 started, EHCI 1.00
690Oct 27 20:18:09 localhost kernel: [ 1.280097] usb usb2: New USB device found, idVendor=1d6b, idProduct=0002
691Oct 27 20:18:09 localhost kernel: [ 1.280099] usb usb2: New USB device strings: Mfr=3, Product=2, SerialNumber=1
692Oct 27 20:18:09 localhost kernel: [ 1.280100] usb usb2: Product: EHCI Host Controller
693Oct 27 20:18:09 localhost kernel: [ 1.280101] usb usb2: Manufacturer: Linux 4.15.0-66-generic ehci_hcd
694Oct 27 20:18:09 localhost kernel: [ 1.280102] usb usb2: SerialNumber: 0000:00:1d.0
695Oct 27 20:18:09 localhost kernel: [ 1.280277] hub 2-0:1.0: USB hub found
696Oct 27 20:18:09 localhost kernel: [ 1.280284] hub 2-0:1.0: 2 ports detected
697Oct 27 20:18:09 localhost kernel: [ 1.280401] ehci-platform: EHCI generic platform driver
698Oct 27 20:18:09 localhost kernel: [ 1.280412] ohci_hcd: USB 1.1 'Open' Host Controller (OHCI) Driver
699Oct 27 20:18:09 localhost kernel: [ 1.280415] ohci-pci: OHCI PCI platform driver
700Oct 27 20:18:09 localhost kernel: [ 1.280423] ohci-platform: OHCI generic platform driver
701Oct 27 20:18:09 localhost kernel: [ 1.280429] uhci_hcd: USB Universal Host Controller Interface driver
702Oct 27 20:18:09 localhost kernel: [ 1.280480] i8042: PNP: No PS/2 controller found.
703Oct 27 20:18:09 localhost kernel: [ 1.280699] mousedev: PS/2 mouse device common for all mice
704Oct 27 20:18:09 localhost kernel: [ 1.281024] rtc_cmos 00:04: RTC can wake from S4
705Oct 27 20:18:09 localhost kernel: [ 1.281191] rtc_cmos 00:04: rtc core: registered rtc_cmos as rtc0
706Oct 27 20:18:09 localhost kernel: [ 1.281224] rtc_cmos 00:04: alarms up to one month, y3k, 114 bytes nvram, hpet irqs
707Oct 27 20:18:09 localhost kernel: [ 1.281231] i2c /dev entries driver
708Oct 27 20:18:09 localhost kernel: [ 1.281281] device-mapper: uevent: version 1.0.3
709Oct 27 20:18:09 localhost kernel: [ 1.281386] device-mapper: ioctl: 4.37.0-ioctl (2017-09-20) initialised: dm-devel@redhat.com
710Oct 27 20:18:09 localhost kernel: [ 1.281391] intel_pstate: Intel P-state driver initializing
711Oct 27 20:18:09 localhost kernel: [ 1.281492] ledtrig-cpu: registered to indicate activity on CPUs
712Oct 27 20:18:09 localhost kernel: [ 1.281859] NET: Registered protocol family 10
713Oct 27 20:18:09 localhost kernel: [ 1.286441] Segment Routing with IPv6
714Oct 27 20:18:09 localhost kernel: [ 1.286470] NET: Registered protocol family 17
715Oct 27 20:18:09 localhost kernel: [ 1.286512] Key type dns_resolver registered
716Oct 27 20:18:09 localhost kernel: [ 1.286685] mce: Using 7 MCE banks
717Oct 27 20:18:09 localhost kernel: [ 1.286696] RAS: Correctable Errors collector initialized.
718Oct 27 20:18:09 localhost kernel: [ 1.286731] microcode: sig=0x206a7, pf=0x2, revision=0x2f
719Oct 27 20:18:09 localhost kernel: [ 1.286775] microcode: Microcode Update Driver: v2.2.
720Oct 27 20:18:09 localhost kernel: [ 1.286788] sched_clock: Marking stable (1286771196, 0)->(1269215103, 17556093)
721Oct 27 20:18:09 localhost kernel: [ 1.286972] registered taskstats version 1
722Oct 27 20:18:09 localhost kernel: [ 1.286981] Loading compiled-in X.509 certificates
723Oct 27 20:18:09 localhost kernel: [ 1.289980] Loaded X.509 cert 'Build time autogenerated kernel key: 01a66adcc10ca4ce7676a3458c33483b0e2b806e'
724Oct 27 20:18:09 localhost kernel: [ 1.290006] zswap: loaded using pool lzo/zbud
725Oct 27 20:18:09 localhost kernel: [ 1.293981] Key type big_key registered
726Oct 27 20:18:09 localhost kernel: [ 1.293986] Key type trusted registered
727Oct 27 20:18:09 localhost kernel: [ 1.295910] Key type encrypted registered
728Oct 27 20:18:09 localhost kernel: [ 1.295914] AppArmor: AppArmor sha1 policy hashing enabled
729Oct 27 20:18:09 localhost kernel: [ 1.295917] ima: No TPM chip found, activating TPM-bypass! (rc=-19)
730Oct 27 20:18:09 localhost kernel: [ 1.295922] ima: Allocated hash algorithm: sha1
731Oct 27 20:18:09 localhost kernel: [ 1.295939] evm: HMAC attrs: 0x1
732Oct 27 20:18:09 localhost kernel: [ 1.296231] Magic number: 7:342:345
733Oct 27 20:18:09 localhost kernel: [ 1.296256] tty tty62: hash matches
734Oct 27 20:18:09 localhost kernel: [ 1.296348] rtc_cmos 00:04: setting system clock to 2019-10-27 19:18:02 UTC (1572203882)
735Oct 27 20:18:09 localhost kernel: [ 1.296431] BIOS EDD facility v0.16 2004-Jun-25, 0 devices found
736Oct 27 20:18:09 localhost kernel: [ 1.296431] EDD information not available.
737Oct 27 20:18:09 localhost kernel: [ 1.299024] Freeing unused kernel image memory: 2436K
738Oct 27 20:18:09 localhost kernel: [ 1.316034] Write protecting the kernel read-only data: 20480k
739Oct 27 20:18:09 localhost kernel: [ 1.316710] Freeing unused kernel image memory: 2008K
740Oct 27 20:18:09 localhost kernel: [ 1.317144] Freeing unused kernel image memory: 1884K
741Oct 27 20:18:09 localhost kernel: [ 1.326504] x86/mm: Checked W+X mappings: passed, no W+X pages found.
742Oct 27 20:18:09 localhost kernel: [ 1.326506] x86/mm: Checking user space page tables
743Oct 27 20:18:09 localhost kernel: [ 1.335430] x86/mm: Checked W+X mappings: passed, no W+X pages found.
744Oct 27 20:18:09 localhost kernel: [ 1.432505] ipmi message handler version 39.2
745Oct 27 20:18:09 localhost kernel: [ 1.433864] ipmi device interface
746Oct 27 20:18:09 localhost kernel: [ 1.440458] ahci 0000:00:1f.2: version 3.0
747Oct 27 20:18:09 localhost kernel: [ 1.450781] ahci 0000:00:1f.2: AHCI 0001.0300 32 slots 4 ports 3 Gbps 0x33 impl SATA mode
748Oct 27 20:18:09 localhost kernel: [ 1.450784] ahci 0000:00:1f.2: flags: 64bit ncq sntf pm led clo pio slum part ems apst
749Oct 27 20:18:09 localhost kernel: [ 1.460450] nvidia: loading out-of-tree module taints kernel.
750Oct 27 20:18:09 localhost kernel: [ 1.460460] nvidia: module license 'NVIDIA' taints kernel.
751Oct 27 20:18:09 localhost kernel: [ 1.460461] Disabling lock debugging due to kernel taint
752Oct 27 20:18:09 localhost kernel: [ 1.473410] atl1c 0000:05:00.0: version 1.0.1.1-NAPI
753Oct 27 20:18:09 localhost kernel: [ 1.474252] nvidia: module verification failed: signature and/or required key missing - tainting kernel
754Oct 27 20:18:09 localhost kernel: [ 1.481614] nvidia-nvlink: Nvlink Core is being initialized, major device number 243
755Oct 27 20:18:09 localhost kernel: [ 1.481927] nvidia 0000:01:00.0: vgaarb: changed VGA decodes: olddecodes=io+mem,decodes=none:owns=io+mem
756Oct 27 20:18:09 localhost kernel: [ 1.485365] NVRM: loading NVIDIA UNIX x86_64 Kernel Module 390.116 Sun Jan 27 07:21:36 PST 2019 (using threaded interrupts)
757Oct 27 20:18:09 localhost kernel: [ 1.492082] scsi host0: ahci
758Oct 27 20:18:09 localhost kernel: [ 1.500220] scsi host1: ahci
759Oct 27 20:18:09 localhost kernel: [ 1.502757] scsi host2: ahci
760Oct 27 20:18:09 localhost kernel: [ 1.503056] scsi host3: ahci
761Oct 27 20:18:09 localhost kernel: [ 1.504743] nvidia-modeset: Loading NVIDIA Kernel Mode Setting Driver for UNIX platforms 390.116 Sun Jan 27 06:30:32 PST 2019
762Oct 27 20:18:09 localhost kernel: [ 1.505517] [drm] [nvidia-drm] [GPU ID 0x00000100] Loading driver
763Oct 27 20:18:09 localhost kernel: [ 1.505519] [drm] Initialized nvidia-drm 0.0.0 20160202 for 0000:01:00.0 on minor 0
764Oct 27 20:18:09 localhost kernel: [ 1.509517] atl1c 0000:05:00.0 enp5s0: renamed from eth0
765Oct 27 20:18:09 localhost kernel: [ 1.510410] scsi host4: ahci
766Oct 27 20:18:09 localhost kernel: [ 1.510817] scsi host5: ahci
767Oct 27 20:18:09 localhost kernel: [ 1.510874] ata1: SATA max UDMA/133 abar m2048@0xfb305000 port 0xfb305100 irq 27
768Oct 27 20:18:09 localhost kernel: [ 1.510877] ata2: SATA max UDMA/133 abar m2048@0xfb305000 port 0xfb305180 irq 27
769Oct 27 20:18:09 localhost kernel: [ 1.510877] ata3: DUMMY
770Oct 27 20:18:09 localhost kernel: [ 1.510878] ata4: DUMMY
771Oct 27 20:18:09 localhost kernel: [ 1.510881] ata5: SATA max UDMA/133 abar m2048@0xfb305000 port 0xfb305300 irq 27
772Oct 27 20:18:09 localhost kernel: [ 1.510883] ata6: SATA max UDMA/133 abar m2048@0xfb305000 port 0xfb305380 irq 27
773Oct 27 20:18:09 localhost kernel: [ 1.596039] usb 1-1: new high-speed USB device number 2 using ehci-pci
774Oct 27 20:18:09 localhost kernel: [ 1.616038] usb 2-1: new high-speed USB device number 2 using ehci-pci
775Oct 27 20:18:09 localhost kernel: [ 1.752509] usb 1-1: New USB device found, idVendor=8087, idProduct=0024
776Oct 27 20:18:09 localhost kernel: [ 1.752511] usb 1-1: New USB device strings: Mfr=0, Product=0, SerialNumber=0
777Oct 27 20:18:09 localhost kernel: [ 1.752863] hub 1-1:1.0: USB hub found
778Oct 27 20:18:09 localhost kernel: [ 1.752956] hub 1-1:1.0: 4 ports detected
779Oct 27 20:18:09 localhost kernel: [ 1.772475] usb 2-1: New USB device found, idVendor=8087, idProduct=0024
780Oct 27 20:18:09 localhost kernel: [ 1.772478] usb 2-1: New USB device strings: Mfr=0, Product=0, SerialNumber=0
781Oct 27 20:18:09 localhost kernel: [ 1.772752] hub 2-1:1.0: USB hub found
782Oct 27 20:18:09 localhost kernel: [ 1.772805] hub 2-1:1.0: 6 ports detected
783Oct 27 20:18:09 localhost kernel: [ 1.826635] ata1: SATA link up 3.0 Gbps (SStatus 123 SControl 300)
784Oct 27 20:18:09 localhost kernel: [ 1.826666] ata2: SATA link up 3.0 Gbps (SStatus 123 SControl 300)
785Oct 27 20:18:09 localhost kernel: [ 1.826683] ata5: SATA link up 1.5 Gbps (SStatus 113 SControl 300)
786Oct 27 20:18:09 localhost kernel: [ 1.826700] ata6: SATA link down (SStatus 0 SControl 300)
787Oct 27 20:18:09 localhost kernel: [ 1.827295] ata1.00: ATA-9: WDC WD30EFRX-68AX9N0, 80.00A80, max UDMA/133
788Oct 27 20:18:09 localhost kernel: [ 1.827298] ata1.00: 5860533168 sectors, multi 16: LBA48 NCQ (depth 31/32), AA
789Oct 27 20:18:09 localhost kernel: [ 1.828048] ata1.00: configured for UDMA/133
790Oct 27 20:18:09 localhost kernel: [ 1.828330] scsi 0:0:0:0: Direct-Access ATA WDC WD30EFRX-68A 0A80 PQ: 0 ANSI: 5
791Oct 27 20:18:09 localhost kernel: [ 1.828584] sd 0:0:0:0: Attached scsi generic sg0 type 0
792Oct 27 20:18:09 localhost kernel: [ 1.828691] sd 0:0:0:0: [sda] 5860533168 512-byte logical blocks: (3.00 TB/2.73 TiB)
793Oct 27 20:18:09 localhost kernel: [ 1.828693] sd 0:0:0:0: [sda] 4096-byte physical blocks
794Oct 27 20:18:09 localhost kernel: [ 1.828704] sd 0:0:0:0: [sda] Write Protect is off
795Oct 27 20:18:09 localhost kernel: [ 1.828706] sd 0:0:0:0: [sda] Mode Sense: 00 3a 00 00
796Oct 27 20:18:09 localhost kernel: [ 1.828726] sd 0:0:0:0: [sda] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA
797Oct 27 20:18:09 localhost kernel: [ 1.829126] ata5.00: ATAPI: ATAPI iHAS122, ZL0F, max UDMA/100
798Oct 27 20:18:09 localhost kernel: [ 1.829912] ata5.00: configured for UDMA/100
799Oct 27 20:18:09 localhost kernel: [ 1.833456] ata2.00: ATA-10: KINGSTON SA400S37120G, R0105A, max UDMA/133
800Oct 27 20:18:09 localhost kernel: [ 1.833459] ata2.00: 234441648 sectors, multi 1: LBA48 NCQ (depth 31/32), AA
801Oct 27 20:18:09 localhost kernel: [ 1.844050] ata2.00: configured for UDMA/133
802Oct 27 20:18:09 localhost kernel: [ 1.844338] scsi 1:0:0:0: Direct-Access ATA KINGSTON SA400S3 5A PQ: 0 ANSI: 5
803Oct 27 20:18:09 localhost kernel: [ 1.844679] sd 1:0:0:0: Attached scsi generic sg1 type 0
804Oct 27 20:18:09 localhost kernel: [ 1.844882] sd 1:0:0:0: [sdb] 234441648 512-byte logical blocks: (120 GB/112 GiB)
805Oct 27 20:18:09 localhost kernel: [ 1.844889] sd 1:0:0:0: [sdb] Write Protect is off
806Oct 27 20:18:09 localhost kernel: [ 1.844891] sd 1:0:0:0: [sdb] Mode Sense: 00 3a 00 00
807Oct 27 20:18:09 localhost kernel: [ 1.844904] sd 1:0:0:0: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA
808Oct 27 20:18:09 localhost kernel: [ 1.845676] sdb: sdb1 sdb2
809Oct 27 20:18:09 localhost kernel: [ 1.846126] sd 1:0:0:0: [sdb] Attached SCSI disk
810Oct 27 20:18:09 localhost kernel: [ 1.848171] scsi 4:0:0:0: CD-ROM ATAPI iHAS122 ZL0F PQ: 0 ANSI: 5
811Oct 27 20:18:09 localhost kernel: [ 1.877895] sda: sda1 sda2 sda3 sda4 sda5 sda6
812Oct 27 20:18:09 localhost kernel: [ 1.878396] sd 0:0:0:0: [sda] Attached SCSI disk
813Oct 27 20:18:09 localhost kernel: [ 1.924823] sr 4:0:0:0: [sr0] scsi3-mmc drive: 48x/48x writer dvd-ram cd/rw xa/form2 cdda tray
814Oct 27 20:18:09 localhost kernel: [ 1.924825] cdrom: Uniform CD-ROM driver Revision: 3.20
815Oct 27 20:18:09 localhost kernel: [ 1.924938] sr 4:0:0:0: Attached scsi CD-ROM sr0
816Oct 27 20:18:09 localhost kernel: [ 1.924992] sr 4:0:0:0: Attached scsi generic sg2 type 5
817Oct 27 20:18:09 localhost kernel: [ 2.040051] usb 1-1.1: new full-speed USB device number 3 using ehci-pci
818Oct 27 20:18:09 localhost kernel: [ 2.060043] usb 2-1.2: new high-speed USB device number 3 using ehci-pci
819Oct 27 20:18:09 localhost kernel: [ 2.150058] usb 1-1.1: New USB device found, idVendor=0403, idProduct=6001
820Oct 27 20:18:09 localhost kernel: [ 2.150061] usb 1-1.1: New USB device strings: Mfr=0, Product=0, SerialNumber=3
821Oct 27 20:18:09 localhost kernel: [ 2.150062] usb 1-1.1: SerialNumber: Reader 3FB4612
822Oct 27 20:18:09 localhost kernel: [ 2.150302] random: fast init done
823Oct 27 20:18:09 localhost kernel: [ 2.150365] random: systemd-udevd: uninitialized urandom read (16 bytes read)
824Oct 27 20:18:09 localhost kernel: [ 2.150372] random: systemd-udevd: uninitialized urandom read (16 bytes read)
825Oct 27 20:18:09 localhost kernel: [ 2.150589] random: systemd-udevd: uninitialized urandom read (16 bytes read)
826Oct 27 20:18:09 localhost kernel: [ 2.168933] usb 2-1.2: New USB device found, idVendor=0781, idProduct=5571
827Oct 27 20:18:09 localhost kernel: [ 2.168935] usb 2-1.2: New USB device strings: Mfr=1, Product=2, SerialNumber=3
828Oct 27 20:18:09 localhost kernel: [ 2.168936] usb 2-1.2: Product: Cruzer Fit
829Oct 27 20:18:09 localhost kernel: [ 2.168937] usb 2-1.2: Manufacturer: SanDisk
830Oct 27 20:18:09 localhost kernel: [ 2.168939] usb 2-1.2: SerialNumber: 4C530010201112117272
831Oct 27 20:18:09 localhost kernel: [ 2.172610] usb-storage 2-1.2:1.0: USB Mass Storage device detected
832Oct 27 20:18:09 localhost kernel: [ 2.172711] scsi host6: usb-storage 2-1.2:1.0
833Oct 27 20:18:09 localhost kernel: [ 2.172781] usbcore: registered new interface driver usb-storage
834Oct 27 20:18:09 localhost kernel: [ 2.174177] usbcore: registered new interface driver uas
835Oct 27 20:18:09 localhost kernel: [ 2.236036] tsc: Refined TSC clocksource calibration: 2394.559 MHz
836Oct 27 20:18:09 localhost kernel: [ 2.236045] clocksource: tsc: mask: 0xffffffffffffffff max_cycles: 0x2284235ba97, max_idle_ns: 440795203400 ns
837Oct 27 20:18:09 localhost kernel: [ 2.248043] usb 2-1.5: new low-speed USB device number 4 using ehci-pci
838Oct 27 20:18:09 localhost kernel: [ 2.363838] usb 2-1.5: New USB device found, idVendor=046a, idProduct=b090
839Oct 27 20:18:09 localhost kernel: [ 2.363841] usb 2-1.5: New USB device strings: Mfr=1, Product=2, SerialNumber=0
840Oct 27 20:18:09 localhost kernel: [ 2.363842] usb 2-1.5: Product: USB keyboard
841Oct 27 20:18:09 localhost kernel: [ 2.363843] usb 2-1.5: Manufacturer: Cherry
842Oct 27 20:18:09 localhost kernel: [ 2.367911] hidraw: raw HID events driver (C) Jiri Kosina
843Oct 27 20:18:09 localhost kernel: [ 2.379215] usbcore: registered new interface driver usbhid
844Oct 27 20:18:09 localhost kernel: [ 2.379217] usbhid: USB HID core driver
845Oct 27 20:18:09 localhost kernel: [ 2.381534] input: Cherry USB keyboard as /devices/pci0000:00/0000:00:1d.0/usb2/2-1/2-1.5/2-1.5:1.0/0003:046A:B090.0001/input/input2
846Oct 27 20:18:09 localhost kernel: [ 2.440296] hid-generic 0003:046A:B090.0001: input,hidraw0: USB HID v1.11 Keyboard [Cherry USB keyboard] on usb-0000:00:1d.0-1.5/input0
847Oct 27 20:18:09 localhost kernel: [ 2.440453] input: Cherry USB keyboard as /devices/pci0000:00/0000:00:1d.0/usb2/2-1/2-1.5/2-1.5:1.1/0003:046A:B090.0002/input/input3
848Oct 27 20:18:09 localhost kernel: [ 2.500506] hid-generic 0003:046A:B090.0002: input,hiddev0,hidraw1: USB HID v1.11 Device [Cherry USB keyboard] on usb-0000:00:1d.0-1.5/input1
849Oct 27 20:18:09 localhost kernel: [ 2.980021] raid6: sse2x1 gen() 7071 MB/s
850Oct 27 20:18:09 localhost kernel: [ 3.028021] raid6: sse2x1 xor() 4844 MB/s
851Oct 27 20:18:09 localhost kernel: [ 3.076019] raid6: sse2x2 gen() 8296 MB/s
852Oct 27 20:18:09 localhost kernel: [ 3.124023] raid6: sse2x2 xor() 5612 MB/s
853Oct 27 20:18:09 localhost kernel: [ 3.172017] raid6: sse2x4 gen() 9881 MB/s
854Oct 27 20:18:09 localhost kernel: [ 3.196729] scsi 6:0:0:0: Direct-Access SanDisk Cruzer Fit 1.27 PQ: 0 ANSI: 6
855Oct 27 20:18:09 localhost kernel: [ 3.197020] sd 6:0:0:0: Attached scsi generic sg3 type 0
856Oct 27 20:18:09 localhost kernel: [ 3.197689] sd 6:0:0:0: [sdc] 31266816 512-byte logical blocks: (16.0 GB/14.9 GiB)
857Oct 27 20:18:09 localhost kernel: [ 3.198689] sd 6:0:0:0: [sdc] Write Protect is off
858Oct 27 20:18:09 localhost kernel: [ 3.198691] sd 6:0:0:0: [sdc] Mode Sense: 43 00 00 00
859Oct 27 20:18:09 localhost kernel: [ 3.199696] sd 6:0:0:0: [sdc] Write cache: disabled, read cache: enabled, doesn't support DPO or FUA
860Oct 27 20:18:09 localhost kernel: [ 3.203955] sdc: sdc1 sdc2 sdc3
861Oct 27 20:18:09 localhost kernel: [ 3.206819] sd 6:0:0:0: [sdc] Attached SCSI disk
862Oct 27 20:18:09 localhost kernel: [ 3.220022] raid6: sse2x4 xor() 6503 MB/s
863Oct 27 20:18:09 localhost kernel: [ 3.220024] raid6: using algorithm sse2x4 gen() 9881 MB/s
864Oct 27 20:18:09 localhost kernel: [ 3.220024] raid6: .... xor() 6503 MB/s, rmw enabled
865Oct 27 20:18:09 localhost kernel: [ 3.220026] raid6: using ssse3x2 recovery algorithm
866Oct 27 20:18:09 localhost kernel: [ 3.221497] xor: measuring software checksum speed
867Oct 27 20:18:09 localhost kernel: [ 3.260019] prefetch64-sse: 12693.000 MB/sec
868Oct 27 20:18:09 localhost kernel: [ 3.300017] generic_sse: 11716.000 MB/sec
869Oct 27 20:18:09 localhost kernel: [ 3.300018] xor: using function: prefetch64-sse (12693.000 MB/sec)
870Oct 27 20:18:09 localhost kernel: [ 3.300039] clocksource: Switched to clocksource tsc
871Oct 27 20:18:09 localhost kernel: [ 3.301379] async_tx: api initialized (async)
872Oct 27 20:18:09 localhost kernel: [ 3.366090] Btrfs loaded, crc32c=crc32c-intel
873Oct 27 20:18:09 localhost kernel: [ 4.087743] EXT4-fs (sdb1): mounted filesystem with ordered data mode. Opts: (null)
874Oct 27 20:18:09 localhost kernel: [ 4.289987] ip_tables: (C) 2000-2006 Netfilter Core Team
875Oct 27 20:18:09 localhost kernel: [ 4.298348] systemd[1]: systemd 237 running in system mode. (+PAM +AUDIT +SELINUX +IMA +APPARMOR +SMACK +SYSVINIT +UTMP +LIBCRYPTSETUP +GCRYPT +GNUTLS +ACL +XZ +LZ4 +SECCOMP +BLKID +ELFUTILS +KMOD -IDN2 +IDN -PCRE2 default-hierarchy=hybrid)
876Oct 27 20:18:09 localhost kernel: [ 4.316149] systemd[1]: Detected architecture x86-64.
877Oct 27 20:18:09 localhost kernel: [ 4.318067] systemd[1]: Set hostname to <myVDR>.
878Oct 27 20:18:09 localhost kernel: [ 4.494670] systemd[1]: vdr-addon-lifeguard-ng.service: Service has a D-Bus service name specified, but is not of type dbus. Ignoring.
879Oct 27 20:18:09 localhost kernel: [ 4.539466] systemd[1]: Reached target User and Group Name Lookups.
880Oct 27 20:18:09 localhost kernel: [ 4.540332] systemd[1]: Created slice User and Session Slice.
881Oct 27 20:18:09 localhost kernel: [ 4.540555] systemd[1]: Set up automount Arbitrary Executable File Formats File System Automount Point.
882Oct 27 20:18:09 localhost kernel: [ 4.540620] systemd[1]: Started Forward Password Requests to Wall Directory Watch.
883Oct 27 20:18:09 localhost kernel: [ 4.540983] systemd[1]: Created slice System Slice.
884Oct 27 20:18:09 localhost kernel: [ 4.541078] systemd[1]: Listening on RPCbind Server Activation Socket.
885Oct 27 20:18:09 localhost kernel: [ 4.594116] Loading iSCSI transport class v2.0-870.
886Oct 27 20:18:09 localhost kernel: [ 4.600956] iscsi: registered transport (tcp)
887Oct 27 20:18:09 localhost kernel: [ 4.617375] EXT4-fs (sdb1): re-mounted. Opts: errors=remount-ro
888Oct 27 20:18:09 localhost kernel: [ 4.655330] iscsi: registered transport (iser)
889Oct 27 20:18:09 localhost kernel: [ 4.742006] systemd-journald[393]: Received request to flush runtime journal from PID 1
890Oct 27 20:18:09 localhost kernel: [ 4.764199] RPC: Registered named UNIX socket transport module.
891Oct 27 20:18:09 localhost kernel: [ 4.764200] RPC: Registered udp transport module.
892Oct 27 20:18:09 localhost kernel: [ 4.764201] RPC: Registered tcp transport module.
893Oct 27 20:18:09 localhost kernel: [ 4.764202] RPC: Registered tcp NFSv4.1 backchannel transport module.
894Oct 27 20:18:09 localhost kernel: [ 4.771201] random: crng init done
895Oct 27 20:18:09 localhost kernel: [ 4.771204] random: 7 urandom warning(s) missed due to ratelimiting
896Oct 27 20:18:09 localhost kernel: [ 4.824882] Installing knfsd (copyright (C) 1996 okir@monad.swb.de).
897Oct 27 20:18:09 localhost kernel: [ 5.118682] systemd-journald[393]: File /var/log/journal/5f8468ca6e4c430ab172e3c83e833eaf/system.journal corrupted or uncleanly shut down, renaming and replacing.
898Oct 27 20:18:09 localhost kernel: [ 5.563978] ACPI Warning: SystemIO range 0x0000000000000540-0x000000000000054F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
899Oct 27 20:18:09 localhost kernel: [ 5.563984] ACPI Warning: SystemIO range 0x0000000000000540-0x000000000000054F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
900Oct 27 20:18:09 localhost kernel: [ 5.563988] ACPI: If an ACPI driver is available for this device, you should use it instead of the native driver
901Oct 27 20:18:09 localhost kernel: [ 5.563989] ACPI Warning: SystemIO range 0x0000000000000530-0x000000000000053F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
902Oct 27 20:18:09 localhost kernel: [ 5.563992] ACPI Warning: SystemIO range 0x0000000000000530-0x000000000000053F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
903Oct 27 20:18:09 localhost kernel: [ 5.563995] ACPI: If an ACPI driver is available for this device, you should use it instead of the native driver
904Oct 27 20:18:09 localhost kernel: [ 5.563996] ACPI Warning: SystemIO range 0x0000000000000500-0x000000000000052F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
905Oct 27 20:18:09 localhost kernel: [ 5.563999] ACPI Warning: SystemIO range 0x0000000000000500-0x000000000000052F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
906Oct 27 20:18:09 localhost kernel: [ 5.564002] ACPI: If an ACPI driver is available for this device, you should use it instead of the native driver
907Oct 27 20:18:09 localhost kernel: [ 5.564002] lpc_ich: Resource conflict(s) found affecting gpio_ich
908Oct 27 20:18:09 localhost kernel: [ 5.574915] shpchp: Standard Hot Plug PCI Controller Driver version: 0.4
909Oct 27 20:18:09 localhost kernel: [ 5.696632] parport_pc 00:02: reported by Plug and Play ACPI
910Oct 27 20:18:09 localhost kernel: [ 5.696722] parport0: PC-style at 0x378 (0x778), irq 5, dma 3 [PCSPP,TRISTATE,COMPAT,EPP,ECP,DMA]
911Oct 27 20:18:09 localhost kernel: [ 5.703762] nvidia-uvm: Loaded the UVM driver in 8 mode, major device number 240
912Oct 27 20:18:09 localhost kernel: [ 5.780970] snd_hda_intel 0000:01:00.1: Disabling MSI
913Oct 27 20:18:09 localhost kernel: [ 5.780977] snd_hda_intel 0000:01:00.1: Handle vga_switcheroo audio client
914Oct 27 20:18:09 localhost kernel: [ 5.781544] snd_hda_codec_realtek hdaudioC0D0: autoconfig for ALC887-VD: line_outs=3 (0x14/0x15/0x16/0x0/0x0) type:line
915Oct 27 20:18:09 localhost kernel: [ 5.781547] snd_hda_codec_realtek hdaudioC0D0: speaker_outs=0 (0x0/0x0/0x0/0x0/0x0)
916Oct 27 20:18:09 localhost kernel: [ 5.781548] snd_hda_codec_realtek hdaudioC0D0: hp_outs=1 (0x1b/0x0/0x0/0x0/0x0)
917Oct 27 20:18:09 localhost kernel: [ 5.781549] snd_hda_codec_realtek hdaudioC0D0: mono: mono_out=0x0
918Oct 27 20:18:09 localhost kernel: [ 5.781550] snd_hda_codec_realtek hdaudioC0D0: dig-out=0x1e/0x0
919Oct 27 20:18:09 localhost kernel: [ 5.781551] snd_hda_codec_realtek hdaudioC0D0: inputs:
920Oct 27 20:18:09 localhost kernel: [ 5.781553] snd_hda_codec_realtek hdaudioC0D0: Front Mic=0x19
921Oct 27 20:18:09 localhost kernel: [ 5.781555] snd_hda_codec_realtek hdaudioC0D0: Rear Mic=0x18
922Oct 27 20:18:09 localhost kernel: [ 5.781556] snd_hda_codec_realtek hdaudioC0D0: Line=0x1a
923Oct 27 20:18:09 localhost kernel: [ 5.797025] nuvoton-cir 00:03: found NCT6776F or compatible: chip id: 0xc3 0x33
924Oct 27 20:18:09 localhost kernel: [ 5.797708] input: HDA Intel PCH Rear Mic as /devices/pci0000:00/0000:00:1b.0/sound/card0/input4
925Oct 27 20:18:09 localhost kernel: [ 5.797779] input: HDA Intel PCH Line as /devices/pci0000:00/0000:00:1b.0/sound/card0/input5
926Oct 27 20:18:09 localhost kernel: [ 5.797833] input: HDA Intel PCH Line Out Front as /devices/pci0000:00/0000:00:1b.0/sound/card0/input6
927Oct 27 20:18:09 localhost kernel: [ 5.797921] input: HDA Intel PCH Line Out Surround as /devices/pci0000:00/0000:00:1b.0/sound/card0/input7
928Oct 27 20:18:09 localhost kernel: [ 5.797983] input: HDA Intel PCH Line Out CLFE as /devices/pci0000:00/0000:00:1b.0/sound/card0/input8
929Oct 27 20:18:09 localhost kernel: [ 5.802118] lirc_dev: IR Remote Control driver registered, major 239
930Oct 27 20:18:09 localhost kernel: [ 5.803725] IR LIRC bridge handler initialized
931Oct 27 20:18:09 localhost kernel: [ 5.836080] Registered IR keymap rc-rc6-mce
932Oct 27 20:18:09 localhost kernel: [ 5.844298] IR RC6 protocol handler initialized
933Oct 27 20:18:09 localhost kernel: [ 5.844314] usbcore: registered new interface driver usbserial_generic
934Oct 27 20:18:09 localhost kernel: [ 5.844325] usbserial: USB Serial support registered for generic
935Oct 27 20:18:09 localhost kernel: [ 5.872116] rc rc0: Nuvoton w836x7hg Infrared Remote Transceiver as /devices/pnp0/00:03/rc/rc0
936Oct 27 20:18:09 localhost kernel: [ 5.872157] input: Nuvoton w836x7hg Infrared Remote Transceiver as /devices/pnp0/00:03/rc/rc0/input9
937Oct 27 20:18:09 localhost kernel: [ 5.874598] lirc lirc0: lirc_dev: driver ir-lirc-codec (nuvoton-cir) registered at minor = 0
938Oct 27 20:18:09 localhost kernel: [ 5.874620] nuvoton-cir 00:03: driver has been successfully loaded
939Oct 27 20:18:09 localhost kernel: [ 5.882118] usbcore: registered new interface driver ftdi_sio
940Oct 27 20:18:09 localhost kernel: [ 5.882129] usbserial: USB Serial support registered for FTDI USB Serial Device
941Oct 27 20:18:09 localhost kernel: [ 5.882411] ftdi_sio 1-1.1:1.0: FTDI USB Serial Device converter detected
942Oct 27 20:18:09 localhost kernel: [ 5.882443] usb 1-1.1: Detected FT232BM
943Oct 27 20:18:09 localhost kernel: [ 5.882668] ftdi_sio ttyUSB0: Unable to read latency timer: -32
944Oct 27 20:18:09 localhost kernel: [ 5.883038] usb 1-1.1: FTDI USB Serial Device converter now attached to ttyUSB0
945Oct 27 20:18:09 localhost kernel: [ 6.128483] saa7146: register extension 'budget_ci dvb'
946Oct 27 20:18:09 localhost kernel: [ 6.128722] saa7146: found saa7146 @ mem 00000000b1b49179 (revision 1, irq 17) (0x13c2,0x1019)
947Oct 27 20:18:09 localhost kernel: [ 6.128724] saa7146 (0): dma buffer size 192512
948Oct 27 20:18:09 localhost kernel: [ 6.128725] dvbdev: DVB: registering new adapter (TT-Budget S2-3200 PCI)
949Oct 27 20:18:09 localhost kernel: [ 6.177088] adapter has MAC addr = 00:d0:5c:68:37:b6
950Oct 27 20:18:09 localhost kernel: [ 6.364732] RAPL PMU: API unit is 2^-32 Joules, 3 fixed counters, 163840 ms ovfl timer
951Oct 27 20:18:09 localhost kernel: [ 6.364735] RAPL PMU: hw unit of domain pp0-core 2^-16 Joules
952Oct 27 20:18:09 localhost kernel: [ 6.364735] RAPL PMU: hw unit of domain package 2^-16 Joules
953Oct 27 20:18:09 localhost kernel: [ 6.364736] RAPL PMU: hw unit of domain pp1-gpu 2^-16 Joules
954Oct 27 20:18:09 localhost kernel: [ 6.368662] input: HDA NVidia HDMI/DP,pcm=3 as /devices/pci0000:00/0000:00:01.0/0000:01:00.1/sound/card1/input11
955Oct 27 20:18:09 localhost kernel: [ 6.368719] input: HDA NVidia HDMI/DP,pcm=7 as /devices/pci0000:00/0000:00:01.0/0000:01:00.1/sound/card1/input12
956Oct 27 20:18:09 localhost kernel: [ 6.380474] Registered IR keymap rc-tt-1500
957Oct 27 20:18:09 localhost kernel: [ 6.380515] rc rc1: Budget-CI dvb ir receiver saa7146 (0) as /devices/pci0000:00/0000:00:1c.1/0000:03:00.0/0000:04:00.0/rc/rc1
958Oct 27 20:18:09 localhost kernel: [ 6.380552] input: Budget-CI dvb ir receiver saa7146 (0) as /devices/pci0000:00/0000:00:1c.1/0000:03:00.0/0000:04:00.0/rc/rc1/input10
959Oct 27 20:18:09 localhost kernel: [ 6.741290] ppdev: user-space parallel port driver
960Oct 27 20:18:09 localhost kernel: [ 6.772937] resource sanity check: requesting [mem 0x000c0000-0x000fffff], which spans more than PCI Bus 0000:00 [mem 0x000c0000-0x000dffff window]
961Oct 27 20:18:09 localhost kernel: [ 6.773204] caller os_map_kernel_space.part.8+0x10b/0x150 [nvidia] mapping multiple BARs
962Oct 27 20:18:09 localhost kernel: [ 7.073699] stb0899_attach: Attaching STB0899
963Oct 27 20:18:09 localhost kernel: [ 7.083834] stb6100_attach: Attaching STB6100
964Oct 27 20:18:09 localhost kernel: [ 7.091753] LNBx2x attached on addr=8
965Oct 27 20:18:09 localhost kernel: [ 7.091757] budget_ci dvb 0000:04:00.0: DVB: registering adapter 0 frontend 0 (STB0899 Multistandard)...
966Oct 27 20:18:09 localhost kernel: [ 7.092004] saa7146: found saa7146 @ mem 000000000530131b (revision 1, irq 18) (0x13c2,0x1019)
967Oct 27 20:18:09 localhost kernel: [ 7.092006] saa7146 (1): dma buffer size 192512
968Oct 27 20:18:09 localhost kernel: [ 7.092007] dvbdev: DVB: registering new adapter (TT-Budget S2-3200 PCI)
969Oct 27 20:18:09 localhost kernel: [ 7.102653] intel_rapl: Found RAPL domain package
970Oct 27 20:18:09 localhost kernel: [ 7.102654] intel_rapl: Found RAPL domain core
971Oct 27 20:18:09 localhost kernel: [ 7.102655] intel_rapl: Found RAPL domain uncore
972Oct 27 20:18:09 localhost kernel: [ 7.102660] intel_rapl: RAPL package 0 domain package locked by BIOS
973Oct 27 20:18:09 localhost kernel: [ 7.145919] adapter has MAC addr = 00:d0:5c:68:30:6d
974Oct 27 20:18:09 localhost kernel: [ 7.160388] Registered IR keymap rc-tt-1500
975Oct 27 20:18:09 localhost kernel: [ 7.160424] rc rc2: Budget-CI dvb ir receiver saa7146 (1) as /devices/pci0000:00/0000:00:1c.1/0000:03:00.0/0000:04:01.0/rc/rc2
976Oct 27 20:18:09 localhost kernel: [ 7.160459] input: Budget-CI dvb ir receiver saa7146 (1) as /devices/pci0000:00/0000:00:1c.1/0000:03:00.0/0000:04:01.0/rc/rc2/input13
977Oct 27 20:18:09 localhost kernel: [ 7.500685] stb0899_attach: Attaching STB0899
978Oct 27 20:18:09 localhost kernel: [ 7.500693] stb6100_attach: Attaching STB6100
979Oct 27 20:18:09 localhost kernel: [ 7.500807] LNBx2x attached on addr=8
980Oct 27 20:18:09 localhost kernel: [ 7.500812] budget_ci dvb 0000:04:01.0: DVB: registering adapter 1 frontend 0 (STB0899 Multistandard)...
981Oct 27 20:18:09 localhost kernel: [ 7.523608] Adding 5242876k swap on /dev/sdb2. Priority:-2 extents:1 across:5242876k SSFS
982Oct 27 20:18:09 localhost kernel: [ 8.274179] EXT4-fs (sda4): mounted filesystem with ordered data mode. Opts: (null)
983Oct 27 20:18:09 localhost kernel: [ 8.495649] atl1c 0000:05:00.0: atl1c: enp5s0 NIC Link is Up<1000 Mbps Full Duplex>
984Oct 27 20:18:09 localhost kernel: [ 8.568083] audit: type=1400 audit(1572203889.767:2): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/sbin/dhclient" pid=831 comm="apparmor_parser"
985Oct 27 20:18:09 localhost kernel: [ 8.568088] audit: type=1400 audit(1572203889.767:3): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/lib/NetworkManager/nm-dhcp-client.action" pid=831 comm="apparmor_parser"
986Oct 27 20:18:09 localhost kernel: [ 8.568090] audit: type=1400 audit(1572203889.767:4): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/lib/NetworkManager/nm-dhcp-helper" pid=831 comm="apparmor_parser"
987Oct 27 20:18:09 localhost kernel: [ 8.568092] audit: type=1400 audit(1572203889.767:5): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/lib/connman/scripts/dhclient-script" pid=831 comm="apparmor_parser"
988Oct 27 20:18:09 localhost kernel: [ 8.575102] audit: type=1400 audit(1572203889.771:6): apparmor="STATUS" operation="profile_load" profile="unconfined" name="lxc-container-default" pid=830 comm="apparmor_parser"
989Oct 27 20:18:09 localhost kernel: [ 8.575107] audit: type=1400 audit(1572203889.771:7): apparmor="STATUS" operation="profile_load" profile="unconfined" name="lxc-container-default-cgns" pid=830 comm="apparmor_parser"
990Oct 27 20:18:09 localhost kernel: [ 8.575108] audit: type=1400 audit(1572203889.771:8): apparmor="STATUS" operation="profile_load" profile="unconfined" name="lxc-container-default-with-mounting" pid=830 comm="apparmor_parser"
991Oct 27 20:18:09 localhost kernel: [ 8.575111] audit: type=1400 audit(1572203889.771:9): apparmor="STATUS" operation="profile_load" profile="unconfined" name="lxc-container-default-with-nesting" pid=830 comm="apparmor_parser"
992Oct 27 20:18:09 localhost kernel: [ 8.576231] audit: type=1400 audit(1572203889.775:10): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/bin/lxc-start" pid=833 comm="apparmor_parser"
993Oct 27 20:18:09 localhost kernel: [ 8.578443] audit: type=1400 audit(1572203889.775:11): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/bin/man" pid=834 comm="apparmor_parser"
994Oct 27 20:18:09 localhost systemd[1]: Started System Logging Service.
995Oct 27 20:18:09 localhost rsyslogd: imuxsock: Acquired UNIX socket '/run/systemd/journal/syslog' (fd 3) from systemd. [v8.32.0]
996Oct 27 20:18:09 localhost rsyslogd: rsyslogd's groupid changed to 106
997Oct 27 20:18:09 localhost rsyslogd: rsyslogd's userid changed to 102
998Oct 27 20:18:09 localhost rsyslogd: [origin software="rsyslogd" swVersion="8.32.0" x-pid="871" x-info="http://www.rsyslog.com"] start
999Oct 27 20:18:09 localhost avahi-daemon[860]: Successfully dropped root privileges.
1000Oct 27 20:18:09 localhost avahi-daemon[860]: avahi-daemon 0.7 starting up.
1001Oct 27 20:18:09 localhost cron[869]: (CRON) INFO (Running @reboot jobs)
1002Oct 27 20:18:09 localhost systemd[1]: Started Save/Restore Sound Card State.
1003Oct 27 20:18:09 localhost systemd[1]: Started Avahi mDNS/DNS-SD Stack.
1004Oct 27 20:18:09 localhost avahi-daemon[860]: Successfully called chroot().
1005Oct 27 20:18:09 localhost avahi-daemon[860]: Successfully dropped remaining capabilities.
1006Oct 27 20:18:09 localhost sensors[900]: coretemp-isa-0000
1007Oct 27 20:18:09 localhost sensors[900]: Adapter: ISA adapter
1008Oct 27 20:18:09 localhost sensors[900]: Package id 0: +38.0°C (high = +82.0°C, crit = +102.0°C)
1009Oct 27 20:18:09 localhost sensors[900]: Core 0: +34.0°C (high = +82.0°C, crit = +102.0°C)
1010Oct 27 20:18:09 localhost sensors[900]: Core 1: +38.0°C (high = +82.0°C, crit = +102.0°C)
1011Oct 27 20:18:09 localhost systemd[1]: Started Initialize hardware monitoring sensors.
1012Oct 27 20:18:09 localhost kernel: [ 8.784920] new mount options do not match the existing superblock, will be ignored
1013Oct 27 20:18:09 localhost grub-common[870]: * Recording successful boot for GRUB
1014Oct 27 20:18:10 localhost lxcfs[877]: mount namespace: 5
1015Oct 27 20:18:10 localhost lxcfs[877]: hierarchies:
1016Oct 27 20:18:10 localhost lxcfs[877]: 0: fd: 6: pids
1017Oct 27 20:18:10 localhost lxcfs[877]: 1: fd: 7: hugetlb
1018Oct 27 20:18:10 localhost lxcfs[877]: 2: fd: 8: rdma
1019Oct 27 20:18:10 localhost lxcfs[877]: 3: fd: 9: cpu,cpuacct
1020Oct 27 20:18:10 localhost lxcfs[877]: 4: fd: 10: memory
1021Oct 27 20:18:10 localhost lxcfs[877]: 5: fd: 11: net_cls,net_prio
1022Oct 27 20:18:10 localhost lxcfs[877]: 6: fd: 12: cpuset
1023Oct 27 20:18:10 localhost lxcfs[877]: 7: fd: 13: freezer
1024Oct 27 20:18:10 localhost lxcfs[877]: 8: fd: 14: devices
1025Oct 27 20:18:10 localhost lxcfs[877]: 9: fd: 15: blkio
1026Oct 27 20:18:10 localhost lxcfs[877]: 10: fd: 16: perf_event
1027Oct 27 20:18:10 localhost lxcfs[877]: 11: fd: 17: name=systemd
1028Oct 27 20:18:10 localhost lxcfs[877]: 12: fd: 18: unified
1029Oct 27 20:18:10 localhost systemd[1]: Started WPA supplicant.
1030Oct 27 20:18:10 localhost wpa_supplicant[884]: Successfully initialized wpa_supplicant
1031Oct 27 20:18:10 localhost systemd[1]: Reached target Network.
1032Oct 27 20:18:10 localhost systemd[1]: Starting MariaDB 10.1.41 database server...
1033Oct 27 20:18:10 localhost systemd[1]: Starting OScam...
1034Oct 27 20:18:10 localhost systemd[1]: Starting NFS Mount Daemon...
1035Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-audio.service.
1036Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-backups.service.
1037Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-files.service.
1038Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-pictures.service.
1039Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-recordings.service.
1040Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-video.service.
1041Oct 27 20:18:10 localhost avahi-daemon[860]: Joining mDNS multicast group on interface enp5s0.IPv6 with address fe80::225:22ff:fee6:40ba.
1042Oct 27 20:18:10 localhost avahi-daemon[860]: New relevant interface enp5s0.IPv6 for mDNS.
1043Oct 27 20:18:10 localhost avahi-daemon[860]: Joining mDNS multicast group on interface enp5s0.IPv4 with address 192.168.192.150.
1044Oct 27 20:18:10 localhost avahi-daemon[860]: New relevant interface enp5s0.IPv4 for mDNS.
1045Oct 27 20:18:10 localhost avahi-daemon[860]: Joining mDNS multicast group on interface lo.IPv6 with address ::1.
1046Oct 27 20:18:10 localhost avahi-daemon[860]: New relevant interface lo.IPv6 for mDNS.
1047Oct 27 20:18:10 localhost avahi-daemon[860]: Joining mDNS multicast group on interface lo.IPv4 with address 127.0.0.1.
1048Oct 27 20:18:10 localhost avahi-daemon[860]: New relevant interface lo.IPv4 for mDNS.
1049Oct 27 20:18:10 localhost avahi-daemon[860]: Network interface enumeration completed.
1050Oct 27 20:18:10 localhost avahi-daemon[860]: Registering new address record for fe80::225:22ff:fee6:40ba on enp5s0.*.
1051Oct 27 20:18:10 localhost avahi-daemon[860]: Registering new address record for 192.168.192.150 on enp5s0.IPv4.
1052Oct 27 20:18:10 localhost avahi-daemon[860]: Registering new address record for ::1 on lo.*.
1053Oct 27 20:18:10 localhost avahi-daemon[860]: Registering new address record for 127.0.0.1 on lo.IPv4.
1054Oct 27 20:18:10 localhost systemd[1]: Started Login Service.
1055Oct 27 20:18:10 localhost systemd[1]: Started Unattended Upgrades Shutdown.
1056Oct 27 20:18:10 localhost systemd[1]: Started LXD - container startup/shutdown.
1057Oct 27 20:18:10 localhost udisksd[879]: udisks daemon version 2.7.6 starting
1058Oct 27 20:18:10 localhost dbus-daemon[883]: [system] Activating via systemd: service name='org.freedesktop.PolicyKit1' unit='polkit.service' requested by ':1.6' (uid=0 pid=881 comm="/usr/lib/accountsservice/accounts-daemon " label="unconfined")
1059Oct 27 20:18:10 localhost systemd[1]: Starting Authorization Manager...
1060Oct 27 20:18:10 localhost systemd[1]: oscam.service: Can't open PID file /var/run/oscam.pid (yet?) after start: No such file or directory
1061Oct 27 20:18:10 localhost grub-common[870]: ...done.
1062Oct 27 20:18:10 localhost systemd[1]: Started LSB: Record successful boot for GRUB.
1063Oct 27 20:18:10 localhost systemd[1]: oscam.service: Supervising process 923 which is not our child. We'll most likely not notice when it exits.
1064Oct 27 20:18:10 localhost systemd[1]: Started OScam.
1065Oct 27 20:18:10 localhost snapd[874]: AppArmor status: apparmor is enabled and all features are available
1066Oct 27 20:18:10 localhost systemd[1]: Started lircd(8) initialization helper tool.
1067Oct 27 20:18:10 localhost udisksd[879]: failed to load module crypto: libbd_crypto.so.2: cannot open shared object file: No such file or directory
1068Oct 27 20:18:10 localhost udisksd[879]: failed to load module mdraid: libbd_mdraid.so.2: cannot open shared object file: No such file or directory
1069Oct 27 20:18:10 localhost udisksd[879]: Failed to load the 'mdraid' libblockdev plugin
1070Oct 27 20:18:10 localhost udisksd[879]: Failed to load the 'crypto' libblockdev plugin
1071Oct 27 20:18:10 localhost kernel: [ 9.043918] ftdi_sio ttyUSB0: FTDI USB Serial Device converter now disconnected from ttyUSB0
1072Oct 27 20:18:10 localhost kernel: [ 9.043935] ftdi_sio 1-1.1:1.0: device disconnected
1073Oct 27 20:18:10 localhost polkitd[920]: started daemon version 0.105 using authority implementation `local' version `0.105'
1074Oct 27 20:18:10 localhost dbus-daemon[883]: [system] Successfully activated service 'org.freedesktop.PolicyKit1'
1075Oct 27 20:18:10 localhost systemd[1]: Started Authorization Manager.
1076Oct 27 20:18:10 localhost accounts-daemon[881]: started daemon version 0.6.45
1077Oct 27 20:18:10 localhost systemd[1]: Started Accounts Service.
1078Oct 27 20:18:10 localhost rpc.mountd[953]: Version 1.3.3 starting
1079Oct 27 20:18:10 localhost systemd[1]: Started NFS Mount Daemon.
1080Oct 27 20:18:10 localhost systemd[1]: Starting NFS server and services...
1081Oct 27 20:18:10 localhost snapd[874]: daemon.go:338: started snapd/2.40+18.04 (series 16; classic) ubuntu/18.04 (amd64) linux/4.15.0-66-generic.
1082Oct 27 20:18:10 localhost nfsdcltrack[958]: Failed to init database: -13
1083Oct 27 20:18:10 localhost kernel: [ 9.148299] NFSD: Using /var/lib/nfs/v4recovery as the NFSv4 state recovery directory
1084Oct 27 20:18:10 localhost kernel: [ 9.148554] NFSD: starting 90-second grace period (net f0000099)
1085Oct 27 20:18:10 localhost networkd-dispatcher[867]: No valid path found for iwconfig
1086Oct 27 20:18:10 localhost systemd[1]: Started NFS server and services.
1087Oct 27 20:18:10 localhost systemd[1]: Started Snappy daemon.
1088Oct 27 20:18:10 localhost systemd[1]: Starting Wait until snapd is fully seeded...
1089Oct 27 20:18:10 localhost systemd[1]: Started Dispatcher daemon for systemd-networkd.
1090Oct 27 20:18:10 localhost systemd[1]: Started Wait until snapd is fully seeded.
1091Oct 27 20:18:10 localhost systemd[1]: Started Disk Manager.
1092Oct 27 20:18:10 localhost udisksd[879]: Acquired the name org.freedesktop.UDisks2 on the system message bus
1093Oct 27 20:18:10 localhost udisksd[879]: Cleaning up mount point /media/vdr/3451-ADE2 (device 8:35 is not mounted)
1094Oct 27 20:18:10 localhost udisksd[879]: Cleaning up mount point /media/vdr/327B-9667 (device 8:33 is not mounted)
1095Oct 27 20:18:10 localhost mysqld[1076]: 2019-10-27 20:18:10 140054344481920 [Note] /usr/sbin/mysqld (mysqld 10.1.41-MariaDB-0ubuntu0.18.04.1) starting as process 1076 ...
1096Oct 27 20:18:10 localhost avahi-daemon[860]: Server startup complete. Host name is myVDR.local. Local service cookie is 1435830800.
1097Oct 27 20:18:11 localhost systemd-networkd[765]: enp5s0: Gained IPv6LL
1098Oct 27 20:18:11 localhost systemd-networkd[765]: enp5s0: Configured
1099Oct 27 20:18:11 localhost systemd-networkd-wait-online[791]: ignoring: lo
1100Oct 27 20:18:11 localhost systemd-networkd-wait-online[791]: managing: enp5s0
1101Oct 27 20:18:11 localhost systemd-timesyncd[762]: Network configuration changed, trying to establish connection.
1102Oct 27 20:18:11 localhost systemd[1]: Started Wait for Network to be Configured.
1103Oct 27 20:18:11 localhost systemd[1]: Reached target Network is Online.
1104Oct 27 20:18:11 localhost systemd[1]: Starting Postfix Mail Transport Agent (instance -)...
1105Oct 27 20:18:11 localhost systemd[1]: Starting Availability of block devices...
1106Oct 27 20:18:11 localhost systemd[1]: Reached target Remote File Systems (Pre).
1107Oct 27 20:18:11 localhost systemd[1]: Reached target Remote File Systems.
1108Oct 27 20:18:11 localhost systemd[1]: Starting LSB: automatic crash report generation...
1109Oct 27 20:18:11 localhost systemd[1]: Starting LSB: Adaptive readahead daemon...
1110Oct 27 20:18:11 localhost systemd[1]: Starting Permit User Sessions...
1111Oct 27 20:18:11 localhost systemd[1]: Starting Samba NMB Daemon...
1112Oct 27 20:18:11 localhost systemd[1]: Starting Automounts filesystems on demand...
1113Oct 27 20:18:11 localhost systemd[1]: Starting OpenBSD Secure Shell server...
1114Oct 27 20:18:11 localhost systemd[1]: Started Availability of block devices.
1115Oct 27 20:18:11 localhost systemd[1]: Started Permit User Sessions.
1116Oct 27 20:18:11 localhost systemd[1]: Starting Hold until boot process finishes up...
1117Oct 27 20:18:11 localhost systemd[1]: Starting Terminate Plymouth Boot Screen...
1118Oct 27 20:18:11 localhost systemd[1]: Received SIGRTMIN+21 from PID 280 (plymouthd).
1119Oct 27 20:18:11 localhost systemd[1]: Started Terminate Plymouth Boot Screen.
1120Oct 27 20:18:11 localhost systemd[1]: Started Hold until boot process finishes up.
1121Oct 27 20:18:11 localhost systemd[1]: Starting Set console scheme...
1122Oct 27 20:18:11 localhost systemd[1]: Starting X on vt7...
1123Oct 27 20:18:11 localhost systemd[1]: Started OpenBSD Secure Shell server.
1124Oct 27 20:18:11 localhost systemd[1]: Started Set console scheme.
1125Oct 27 20:18:11 localhost systemd[1]: Created slice system-getty.slice.
1126Oct 27 20:18:11 localhost systemd[1]: Started Getty on tty1.
1127Oct 27 20:18:11 localhost systemd[1]: Reached target Login Prompts.
1128Oct 27 20:18:11 localhost apport[1102]: * Starting automatic crash report generation: apport
1129Oct 27 20:18:11 localhost x-daemon[1147]: X.Org X Server 1.19.6
1130Oct 27 20:18:11 localhost x-daemon[1147]: Release Date: 2017-12-20
1131Oct 27 20:18:11 localhost x-daemon[1147]: X Protocol Version 11, Revision 0
1132Oct 27 20:18:11 localhost x-daemon[1147]: Build Operating System: Linux 4.4.0-148-generic x86_64 Ubuntu
1133Oct 27 20:18:11 localhost x-daemon[1147]: Current Operating System: Linux myVDR 4.15.0-66-generic #75-Ubuntu SMP Tue Oct 1 05:24:09 UTC 2019 x86_64
1134Oct 27 20:18:11 localhost x-daemon[1147]: Kernel command line: BOOT_IMAGE=/boot/vmlinuz-4.15.0-66-generic root=UUID=3a2488fb-8ae8-4722-b647-c95071d7e0af ro quiet splash vt.handoff=1
1135Oct 27 20:18:11 localhost x-daemon[1147]: Build Date: 03 June 2019 08:10:35AM
1136Oct 27 20:18:11 localhost x-daemon[1147]: xorg-server 2:1.19.6-1ubuntu4.3 (For technical support please see http://www.ubuntu.com/support)
1137Oct 27 20:18:11 localhost x-daemon[1147]: Current version of pixman: 0.34.0
1138Oct 27 20:18:11 localhost x-daemon[1147]: #011Before reporting problems, check http://wiki.x.org
1139Oct 27 20:18:11 localhost x-daemon[1147]: #011to make sure that you have the latest version.
1140Oct 27 20:18:11 localhost x-daemon[1147]: Markers: (--) probed, (**) from config file, (==) default setting,
1141Oct 27 20:18:11 localhost x-daemon[1147]: #011(++) from command line, (!!) notice, (II) informational,
1142Oct 27 20:18:11 localhost x-daemon[1147]: #011(WW) warning, (EE) error, (NI) not implemented, (??) unknown.
1143Oct 27 20:18:11 localhost x-daemon[1147]: (==) Log file: "/var/log/Xorg.0.log", Time: Sun Oct 27 20:18:11 2019
1144Oct 27 20:18:11 localhost x-daemon[1147]: (==) Using config file: "/etc/X11/xorg.conf"
1145Oct 27 20:18:11 localhost x-daemon[1147]: (==) Using config directory: "/etc/X11/xorg.conf.d"
1146Oct 27 20:18:11 localhost x-daemon[1147]: (==) Using system config directory "/usr/share/X11/xorg.conf.d"
1147Oct 27 20:18:11 localhost preload[1105]: * Starting Adaptive readahead daemon preload
1148Oct 27 20:18:11 localhost systemd[1]: Started Automounts filesystems on demand.
1149Oct 27 20:18:11 localhost systemd[1]: Started Avahi linker.
1150Oct 27 20:18:11 localhost systemd[1]: Started prevent-umount-on-pause.service.
1151Oct 27 20:18:11 localhost systemd[1]: Started vdr-update-monitor.
1152Oct 27 20:18:11 localhost apport[1102]: ...done.
1153Oct 27 20:18:11 localhost systemd[1]: Started LSB: automatic crash report generation.
1154Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Video on myVDR" (/services/yavdr-video.service) successfully established.
1155Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Recordings on myVDR" (/services/yavdr-recordings.service) successfully established.
1156Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Pictures on myVDR" (/services/yavdr-pictures.service) successfully established.
1157Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Files on myVDR" (/services/yavdr-files.service) successfully established.
1158Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Backups on myVDR" (/services/yavdr-backups.service) successfully established.
1159Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Audio on myVDR" (/services/yavdr-audio.service) successfully established.
1160Oct 27 20:18:11 localhost systemd[1]: Started Samba NMB Daemon.
1161Oct 27 20:18:11 localhost systemd[1]: Starting Samba SMB Daemon...
1162Oct 27 20:18:11 localhost preload[1105]: ...done.
1163Oct 27 20:18:11 localhost systemd[1]: Started LSB: Adaptive readahead daemon.
1164Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,275 INFO Started avahi-linker
1165Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,307 INFO skip local service 'Video on myVDR' type '_nfs._tcp' domain 'local'
1166Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,307 INFO skip local service 'Recordings on myVDR' type '_nfs._tcp' domain 'local'
1167Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Pictures on myVDR' type '_nfs._tcp' domain 'local'
1168Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Files on myVDR' type '_nfs._tcp' domain 'local'
1169Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Backups on myVDR' type '_nfs._tcp' domain 'local'
1170Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Audio on myVDR' type '_nfs._tcp' domain 'local'
1171Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Video on myVDR' type '_nfs._tcp' domain 'local'
1172Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Recordings on myVDR' type '_nfs._tcp' domain 'local'
1173Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Pictures on myVDR' type '_nfs._tcp' domain 'local'
1174Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Files on myVDR' type '_nfs._tcp' domain 'local'
1175Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Backups on myVDR' type '_nfs._tcp' domain 'local'
1176Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Audio on myVDR' type '_nfs._tcp' domain 'local'
1177Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Video on myVDR' type '_nfs._tcp' domain 'local'
1178Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Recordings on myVDR' type '_nfs._tcp' domain 'local'
1179Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Pictures on myVDR' type '_nfs._tcp' domain 'local'
1180Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Files on myVDR' type '_nfs._tcp' domain 'local'
1181Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Backups on myVDR' type '_nfs._tcp' domain 'local'
1182Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,311 INFO skip local service 'Audio on myVDR' type '_nfs._tcp' domain 'local'
1183Oct 27 20:18:12 localhost kernel: [ 11.128854] resource sanity check: requesting [mem 0x000c0000-0x000fffff], which spans more than PCI Bus 0000:00 [mem 0x000c0000-0x000dffff window]
1184Oct 27 20:18:12 localhost kernel: [ 11.129108] caller os_map_kernel_space.part.8+0x10b/0x150 [nvidia] mapping multiple BARs
1185Oct 27 20:18:12 localhost systemd[1]: Started Samba SMB Daemon.
1186Oct 27 20:18:12 localhost systemd[1]: Starting NVIDIA Persistence Daemon...
1187Oct 27 20:18:12 localhost systemd[1]: Started NVIDIA Persistence Daemon.
1188Oct 27 20:18:12 localhost nvidia-persistenced: Verbose syslog connection opened
1189Oct 27 20:18:12 localhost nvidia-persistenced: Now running with user ID 111 and group ID 116
1190Oct 27 20:18:12 localhost nvidia-persistenced: Started (1549)
1191Oct 27 20:18:12 localhost nvidia-persistenced: device 0000:01:00.0 - registered
1192Oct 27 20:18:12 localhost nvidia-persistenced: Local RPC service initialized
1193Oct 27 20:18:12 localhost systemd[1]: Started ACPI event daemon.
1194Oct 27 20:18:12 localhost acpid: starting up with netlink and the input layer
1195Oct 27 20:18:12 localhost acpid: 0 rules loaded
1196Oct 27 20:18:12 localhost acpid: waiting for events: event logging is off
1197Oct 27 20:18:12 localhost acpid: client connected from 1149[0:0]
1198Oct 27 20:18:12 localhost acpid: 1 client rule loaded
1199Oct 27 20:18:13 localhost systemd[1]: Started X on vt7.
1200Oct 27 20:18:13 localhost systemd[1]: Starting Video Disk Recorder...
1201Oct 27 20:18:13 localhost systemd[1]: Started Direct X login for user vdr.
1202Oct 27 20:18:13 localhost systemd[1]: Starting Start a X session and a systemd user session for the vdr user...
1203Oct 27 20:18:13 localhost systemd[1]: Started Start a X session and a systemd user session for the vdr user.
1204Oct 27 20:18:13 localhost systemd[1]: Created slice User Slice of vdr.
1205Oct 27 20:18:13 localhost systemd[1]: Starting User Manager for UID 666...
1206Oct 27 20:18:13 localhost systemd[1]: Started Session 1 of user vdr.
1207Oct 27 20:18:13 localhost vdr: [1799] VDR version 2.4.0 started
1208Oct 27 20:18:13 localhost vdr: [1799] switched to user 'vdr'
1209Oct 27 20:18:13 localhost vdr: [1799] codeset is 'UTF-8' - known
1210Oct 27 20:18:13 localhost systemd[1773]: Starting D-Bus User Message Bus Socket.
1211Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG cryptographic agent (ssh-agent emulation).
1212Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG cryptographic agent and passphrase cache (access for web browsers).
1213Oct 27 20:18:13 localhost systemd[1773]: Listening on Sound System.
1214Oct 27 20:18:13 localhost systemd[1773]: Reached target Timers.
1215Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG cryptographic agent and passphrase cache.
1216Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG network certificate management daemon.
1217Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG cryptographic agent and passphrase cache (restricted).
1218Oct 27 20:18:13 localhost systemd[1773]: Reached target Paths.
1219Oct 27 20:18:13 localhost systemd[1773]: Listening on D-Bus User Message Bus Socket.
1220Oct 27 20:18:13 localhost systemd[1773]: Reached target Sockets.
1221Oct 27 20:18:13 localhost systemd[1773]: Reached target Basic System.
1222Oct 27 20:18:13 localhost systemd[1]: Started User Manager for UID 666.
1223Oct 27 20:18:13 localhost systemd[1773]: Started exit window manager gracefully.
1224Oct 27 20:18:13 localhost systemd[1773]: Starting Start tmux in detached session...
1225Oct 27 20:18:13 localhost systemd[1773]: Starting Sound Service...
1226Oct 27 20:18:13 localhost systemd[1773]: Started Start tmux in detached session.
1227Oct 27 20:18:13 localhost systemd[1773]: Started D-Bus User Message Bus.
1228Oct 27 20:18:13 localhost dbus-daemon[1864]: [session uid=666 pid=1864] AppArmor D-Bus mediation is enabled
1229Oct 27 20:18:13 localhost postfix/postfix-script[1872]: starting the Postfix mail system
1230Oct 27 20:18:13 localhost vdr: [1799] found 28 locales in /usr/share/locale
1231Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-dvbapi.so.2.4.0
1232Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-conflictcheckonly.so.2.4.0
1233Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-dbus2vdr.so.2.4.0
1234Oct 27 20:18:13 localhost vdr: [1799] dbus2vdr: use shutdown-hooks in /usr/share/vdr/shutdown-hooks
1235Oct 27 20:18:13 localhost vdr: [1799] dbus2vdr: use shutdown-hooks-wrapper /usr/share/vdr-plugin-dbus2vdr/shutdown-wrapper
1236Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-desktop.so.2.4.0
1237Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-devstatus.so.2.4.0
1238Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-epg2vdr.so.2.4.0
1239Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-epgsearch.so.2.4.0
1240Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-epgsearchonly.so.2.4.0
1241Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-live.so.2.4.0
1242Oct 27 20:18:13 localhost vdr: [1799] [live] INFO: validating server ip '0.0.0.0'
1243Oct 27 20:18:13 localhost vdr[1799]: INFO: validating live server ip '0.0.0.0'
1244Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-markad.so.2.4.0
1245Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-menuorg.so.2.4.0
1246Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-osd2web.so.2.4.0
1247Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-osdteletext.so.2.4.0
1248Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-pulsecontrol.so.2.4.0
1249Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-quickepgsearch.so.2.4.0
1250Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-scraper2vdr.so.2.4.0
1251Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-skindesigner.so.2.4.0
1252Oct 27 20:18:13 localhost postfix/master[1876]: daemon started -- version 3.3.0, configuration /etc/postfix
1253Oct 27 20:18:13 localhost systemd[1]: Started Postfix Mail Transport Agent (instance -).
1254Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-softhddevice.so.2.4.0
1255Oct 27 20:18:13 localhost systemd[1]: Starting Postfix Mail Transport Agent...
1256Oct 27 20:18:13 localhost systemd[1]: Started Postfix Mail Transport Agent.
1257Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-streamdev-server.so.2.4.0
1258Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-wirbelscan.so.2.4.0
1259Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/setup.conf
1260Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/sources.conf
1261Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/diseqc.conf
1262Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/scr.conf
1263Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/channels.conf
1264Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/timers.conf
1265Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/commands.conf
1266Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/reccmds.conf
1267Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/svdrphosts.conf
1268Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/remote.conf
1269Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/keymacros.conf
1270Oct 27 20:18:13 localhost vdr: [1799] ERROR: unknown plugin 'xineliboutput'
1271Oct 27 20:18:13 localhost vdr: [1907] video directory scanner thread started (pid=1799, tid=1907, prio=low)
1272Oct 27 20:18:13 localhost vdr: [1908] epg data reader thread started (pid=1799, tid=1908, prio=high)
1273Oct 27 20:18:13 localhost vdr: [1908] reading EPG data from /var/cache/vdr/epg.data
1274Oct 27 20:18:13 localhost vdr: [1799] registered source parameters for 'A - ATSC'
1275Oct 27 20:18:13 localhost vdr: [1799] registered source parameters for 'C - DVB-C'
1276Oct 27 20:18:13 localhost vdr: [1799] registered source parameters for 'S - DVB-S'
1277Oct 27 20:18:13 localhost vdr: [1799] registered source parameters for 'T - DVB-T'
1278Oct 27 20:18:13 localhost vdr: [1799] probing /dev/dvb/adapter0/frontend0
1279Oct 27 20:18:13 localhost vdr: [1799] creating cDvbDevice
1280Oct 27 20:18:13 localhost vdr: [1799] new device number 1
1281Oct 27 20:18:13 localhost bash[1749]: Openbox-Message: Keine gültige Menü-Datei "/var/lib/openbox/debian-menu.xml" vorhanden
1282Oct 27 20:18:13 localhost vdr: [1799] DVB API version is 0x050A (VDR was built with 0x050A)
1283Oct 27 20:18:13 localhost vdr: [1799] frontend 0/0 provides DVB-S,DVB-S2,DSS with QPSK ("STB0899 Multistandard")
1284Oct 27 20:18:13 localhost vdr: [1799] cTimeMs: using monotonic clock (resolution is 1 ns)
1285Oct 27 20:18:13 localhost vdr: [1799] probing /dev/dvb/adapter1/frontend0
1286Oct 27 20:18:13 localhost vdr: [1799] creating cDvbDevice
1287Oct 27 20:18:13 localhost vdr: [1799] new device number 2
1288Oct 27 20:18:13 localhost vdr: [1920] frontend 0/0 tuner thread started (pid=1799, tid=1920, prio=high)
1289Oct 27 20:18:13 localhost vdr: [1921] device 1 section handler thread started (pid=1799, tid=1921, prio=low)
1290Oct 27 20:18:14 localhost systemd[1773]: Reloading.
1291Oct 27 20:18:14 localhost vdr: [1799] frontend 1/0 provides DVB-S,DVB-S2,DSS with QPSK ("STB0899 Multistandard")
1292Oct 27 20:18:14 localhost vdr: [1799] found 2 DVB devices
1293Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: dvbapi (2.2.5): SoftCAM für OSCam
1294Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: conflictcheckonly (0.0.1): Direkter Zugriff auf epgsearch's Konflikt-Prüfungs-Menü
1295Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: dbus2vdr (31): Steuerung des VDR über D-Bus
1296Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: desktop (0.0.3): desktop apps menu
1297Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: devstatus (0.4.1): DVB-Gerätestatus
1298Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: epg2vdr (1.1.98-GIT): epg2vdr plugin
1299Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: epgsearch (2.4.0): Suche im EPG nach Wiederholungen und anderem
1300Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: epgsearchonly (0.0.1): Direkter Zugriff auf epgsearch's Suchenmenu
1301Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: live (2.3.1): Live Interactive VDR Environment
1302Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: markad (0.1.6): Markiere Werbung
1303Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: menuorg (0.5.2): Reorganisiert das Haupmenü
1304Oct 27 20:18:14 localhost vdr: [1799] loading menuorg config file from /var/lib/vdr/plugins/menuorg.xml
1305Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: osd2web (0.2.48-GIT): osd2web plugin
1306Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: osdteletext (0.9.7): Zeigt den Videotext auf dem OSD an
1307Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: pulsecontrol (0.2.1): Pulseaudio über das OSD steuern
1308Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: quickepgsearch (0.0.1): Schnelle Suche nach Sendungen
1309Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: scraper2vdr (1.0.11-GIT): 'scraper2vdr' plugin
1310Oct 27 20:18:14 localhost vdr: scraper2vdr: using image directory /var/cache/vdr/epgimages/
1311Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: skindesigner (1.2.8): Skin Designer
1312Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: softhddevice (0.6.1rc1): Ein Software und GPU emulieres HD-Gerät
1313Oct 27 20:18:14 localhost vdr: [1799] new device number 3
1314Oct 27 20:18:14 localhost vdr: [1932] device 2 section handler thread started (pid=1799, tid=1932, prio=low)
1315Oct 27 20:18:14 localhost vdr: [1931] frontend 1/0 tuner thread started (pid=1799, tid=1931, prio=high)
1316Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: streamdev-server (0.6.1-git): VDR Streaming Server
1317Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: wirbelscan (2017.06.04): DVB channel scan for VDR
1318Oct 27 20:18:14 localhost vdr: [1799] setting primary device to 3
1319Oct 27 20:18:14 localhost vdr: [1799] [softhddev]MakePrimaryDevice: 1
1320Oct 27 20:18:14 localhost vdr: [1799] [softhddev]stopping OpenGL Worker Thread
1321Oct 27 20:18:14 localhost vdr: [1799] [softhddev]OpenGL Worker Thread stopped
1322Oct 27 20:18:14 localhost vdr: [1799] [softhddev]SetVideoFormat: 1
1323Oct 27 20:18:14 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1324Oct 27 20:18:14 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1325Oct 27 20:18:14 localhost vdr: [1799] [softhddev]SetVolumeDevice: 55
1326Oct 27 20:18:14 localhost vdr: [1799] assuming manual start of VDR
1327Oct 27 20:18:14 localhost vdr: [1799] skin "mynew_estuary" not available - using "lcars" instead
1328Oct 27 20:18:14 localhost vdr: [1799] loading /var/lib/vdr/themes/lcars-default.theme
1329Oct 27 20:18:14 localhost vdr: [1799] starting plugin: dvbapi
1330Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: plugin version 2.2.5 initializing (VDR 2.4.0)
1331Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: decryption library: libdvbcsa
1332Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: Creating sCCIAdapter
1333Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: Creating SCCAMSlot for device 1
1334Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: Creating SCCAMSlot for device 2
1335Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: plugin started
1336Oct 27 20:18:14 localhost vdr: [1799] starting plugin: conflictcheckonly
1337Oct 27 20:18:14 localhost vdr: [1799] starting plugin: dbus2vdr
1338Oct 27 20:18:14 localhost vdr: [1934] Socket Handler thread started (pid=1799, tid=1934, prio=high)
1339Oct 27 20:18:14 localhost vdr: [1937] dbus2vdr: mainloop started
1340Oct 27 20:18:14 localhost vdr: [1799] starting plugin: desktop
1341Oct 27 20:18:14 localhost vdr: [1799] starting plugin: devstatus
1342Oct 27 20:18:14 localhost vdr: [1799] starting plugin: epg2vdr
1343Oct 27 20:18:14 localhost vdr: epg2vdr: Info: Calling mysql_library_init()
1344Oct 27 20:18:14 localhost vdr: epg2vdr: Set locale to 'de_AT.UTF-8'
1345Oct 27 20:18:14 localhost vdr: epg2vdr: detected UTF-8
1346Oct 27 20:18:14 localhost vdr: epg2vdr: Dictionary '/var/lib/vdr/plugins/epg2vdr//epg.dat' loaded
1347Oct 27 20:18:14 localhost vdr: [1936] SC-CI adapter thread started (pid=1799, tid=1936, prio=high)
1348Oct 27 20:18:14 localhost vdr: [1799] starting plugin: epgsearch
1349Oct 27 20:18:14 localhost vdr: [1799] loading /var/lib/vdr/plugins/epgsearch/epgsearchcats.conf
1350Oct 27 20:18:14 localhost vdr: [1799] loading /var/lib/vdr/plugins/epgsearch/epgsearchmenu.conf
1351Oct 27 20:18:14 localhost vdr: [1940] epg2vdr-update thread started (pid=1799, tid=1940, prio=high)
1352Oct 27 20:18:14 localhost vdr: epg2vdr: Error, connecting to database at 'localhost' on port (3306) failed
1353Oct 27 20:18:14 localhost vdr: epg2vdr: Could not access database 'localhost:3306'
1354Oct 27 20:18:14 localhost vdr: epg2vdr: Could not access database 'localhost:3306' (tried to open vdrs)
1355Oct 27 20:18:14 localhost vdr: [1937] dbus2vdr: System: connected with unique name :1.30
1356Oct 27 20:18:14 localhost vdr: [1937] dbus2vdr: thread-pool for handling signal-emits started
1357Oct 27 20:18:14 localhost avahi-linker[1162]: 2019-10-27 20:18:14,142 INFO VDR started
1358Oct 27 20:18:14 localhost systemd[1773]: Reloading.
1359Oct 27 20:18:14 localhost systemd[1773]: message repeated 4 times: [ Reloading.]
1360Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 0.0: doReply changed, reset triggered
1361Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 0.0: now using CAIDs version 1
1362Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 0.0: status 'present'
1363Oct 27 20:18:14 localhost vdr: [1936] CAM 1: module present
1364Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 1.1: doReply changed, reset triggered
1365Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 1.1: now using CAIDs version 1
1366Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 1.1: status 'present'
1367Oct 27 20:18:14 localhost vdr: [1936] CAM 2: module present
1368Oct 27 20:18:14 localhost systemd[1773]: Reloading.
1369Oct 27 20:18:14 localhost systemd[1773]: message repeated 2 times: [ Reloading.]
1370Oct 27 20:18:14 localhost set-cpufreq[873]: Setting powersave scheduler for all CPUs
1371Oct 27 20:18:14 localhost systemd[1773]: Started Sound Service.
1372Oct 27 20:18:14 localhost systemd[1773]: Reached target Default.
1373Oct 27 20:18:14 localhost systemd[1773]: Startup finished in 1.830s.
1374Oct 27 20:18:14 localhost vdr: [1908] epg data reader thread ended (pid=1799, tid=1908)
1375Oct 27 20:18:14 localhost systemd[1773]: Started LIRC command handler.
1376Oct 27 20:18:14 localhost systemd[1773]: Starting Detect second DISPLAY using xrandr...
1377Oct 27 20:18:14 localhost vdr: [1799] starting plugin: epgsearchonly
1378Oct 27 20:18:14 localhost vdr: [2046] EPGSearch: conflictcheck thread started (pid=1799, tid=2046, prio=high)
1379Oct 27 20:18:14 localhost vdr: [1799] starting plugin: live
1380Oct 27 20:18:14 localhost vdr: [1799] LIVE: initial file cache has 82 entries and needs 376715 bytes of data!
1381Oct 27 20:18:14 localhost vdr: [1799] starting plugin: markad
1382Oct 27 20:18:14 localhost vdr: [1799] starting plugin: menuorg
1383Oct 27 20:18:14 localhost vdr: [1799] starting plugin: osd2web
1384Oct 27 20:18:14 localhost vdr: [1799] starting plugin: osdteletext
1385Oct 27 20:18:14 localhost vdr: osd2web: osd2web plugin thread started (pid=1799)
1386Oct 27 20:18:14 localhost vdr: [1799] OSD-Teletext: Error statfs'ing root directory "/run/shm/vtx": Datei oder Verzeichnis nicht gefunden, cache size uncontrolled
1387Oct 27 20:18:14 localhost vdr: [1799] starting plugin: pulsecontrol
1388Oct 27 20:18:14 localhost vdr: [2047] [live] INFO: attempt to listen on ip = '0.0.0.0'
1389Oct 27 20:18:14 localhost vdr[1799]: vdr: error while reading '/var/lib/vdr/plugins/pulsecontrol/startup.script'
1390Oct 27 20:18:14 localhost vdr: [1799] pulsecontrol: error on reading script /var/lib/vdr/plugins/pulsecontrol/startup.script
1391Oct 27 20:18:14 localhost vdr: [1799] starting plugin: quickepgsearch
1392Oct 27 20:18:14 localhost vdr: [1799] starting plugin: scraper2vdr
1393Oct 27 20:18:14 localhost vdr: epg2vdr: Info: Skipping calling mysql_library_init(), it's already done!
1394Oct 27 20:18:14 localhost vdr: scraper2vdr: Set locale to 'de_AT.UTF-8'
1395Oct 27 20:18:14 localhost vdr: scraper2vdr: detected UTF-8
1396Oct 27 20:18:14 localhost vdr: osd2web: Listener at port (4444) established
1397Oct 27 20:18:14 localhost vdr: osd2web: using libwebsocket version '2.4.1 unknown-build-hash'
1398Oct 27 20:18:14 localhost vdr: [2047] [live] ERROR: Unable to load cert/key (/var/lib/vdr/plugins/live/live.pem//var/lib/vdr/plugins/live/live-key.pem): Datei oder Verzeichnis nicht gefunden
1399Oct 27 20:18:14 localhost vdr: scraper2vdr: Dictionary '/var/lib/vdr/plugins/scraper2vdr/epg.dat' loaded
1400Oct 27 20:18:14 localhost vdr: [1799] starting plugin: skindesigner
1401Oct 27 20:18:14 localhost vdr: [1799] skindesigner: TrueColor OSD found
1402Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using libskindesigner API Version 0.1.2
1403Oct 27 20:18:14 localhost vdr: [1799] skindesigner: plugin setup uses libskindesigner API Version 0.1.2
1404Oct 27 20:18:14 localhost vdr: [1799] skindesigner: plugin setup has registered 1 menus
1405Oct 27 20:18:14 localhost vdr: [1799] skindesigner: skinsetup template successfully registered at skindesigner, id 0
1406Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using Skin Directory /usr/share/vdr/plugins/skindesigner/skins/
1407Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using Installer Skin Directory /var/lib/vdr/plugins/skindesigner/installerskins/
1408Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using common ChannelLogo Directory /usr/share/vdr/plugins/skindesigner/logos/
1409Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using EPG Images Directory /var/cache/vdr/epgimages/
1410Oct 27 20:18:14 localhost vdr: [1799] skindesigner 3 skins found in /usr/share/vdr/plugins/skindesigner/skins/
1411Oct 27 20:18:14 localhost vdr: [2057] scraper2vdr-update thread started (pid=1799, tid=2057, prio=low)
1412Oct 27 20:18:14 localhost vdr: [1799] skindesigner 0 skins found in /var/lib/vdr/plugins/skindesigner/installerskins/
1413Oct 27 20:18:14 localhost detect-second-display[2043]: Can't open display :0.1
1414Oct 27 20:18:14 localhost systemd[1773]: Started Detect second DISPLAY using xrandr.
1415Oct 27 20:18:14 localhost systemd[1773]: Started manage VDR frontends.
1416Oct 27 20:18:14 localhost systemd[1773]: Reached target yaVDR Desktop.
1417Oct 27 20:18:15 localhost vdr: [1799] skindesigner: skin mynew_estuary started
1418Oct 27 20:18:15 localhost vdr: [1799] skindesigner: skin estuary4vdr started
1419Oct 27 20:18:15 localhost vdr: [1799] skindesigner: skin metrixhd started
1420Oct 27 20:18:15 localhost vdr: [1799] starting plugin: softhddevice
1421Oct 27 20:18:15 localhost vdr: [softhddev] ready detached
1422Oct 27 20:18:15 localhost vdr: [1799] starting plugin: streamdev-server
1423Oct 27 20:18:15 localhost vdr: [1799] loading /var/lib/vdr/plugins/streamdev-server/streamdevhosts.conf
1424Oct 27 20:18:15 localhost vdr: [1799] starting plugin: wirbelscan
1425Oct 27 20:18:15 localhost vdr: [2064] streamdev server thread started (pid=1799, tid=2064, prio=high)
1426Oct 27 20:18:15 localhost vdr: [2064] Streamdev: Listening (VTP) on port 2004
1427Oct 27 20:18:15 localhost vdr: [2064] Streamdev: Listening (HTTP) on port 3000
1428Oct 27 20:18:15 localhost vdr: [1799] setting current skin to "mynew_estuary"
1429Oct 27 20:18:15 localhost vdr: [1799] loading /var/lib/vdr/themes/mynew_estuary-default.theme
1430Oct 27 20:18:15 localhost vdr: [1799] remote control LIRC - keys known
1431Oct 27 20:18:15 localhost vdr: [2065] LIRC remote control thread started (pid=1799, tid=2065, prio=high)
1432Oct 27 20:18:15 localhost vdr: [1799] loading /var/cache/vdr/cam.data
1433Oct 27 20:18:15 localhost bash[1749]: ERROR: openbox-xdg-autostart requires PyXDG to be installed
1434Oct 27 20:18:15 localhost vdr: [1799] DVBAPI: 0.0: status 'reset'
1435Oct 27 20:18:15 localhost vdr: [1936] DVBAPI: 0.0: status 'ready'
1436Oct 27 20:18:15 localhost vdr: [1936] CAM 1: module ready
1437Oct 27 20:18:15 localhost vdr: [1936] DVBAPI: 1.1: status 'reset'
1438Oct 27 20:18:15 localhost vdr: [1936] CAM 2: module reset
1439Oct 27 20:18:15 localhost vdr: [1799] DVBAPI: 1.1: status 'ready'
1440Oct 27 20:18:15 localhost vdr: [1936] DVBAPI: CaInfo: 0.0 sending CA info
1441Oct 27 20:18:15 localhost vdr: [1936] CAM 1: system ids: FFFF
1442Oct 27 20:18:15 localhost vdr: [1936] CAM 1: replies to QUERY - multi channel decryption (MCD) possible
1443Oct 27 20:18:15 localhost bash[1749]: Typelib for 'libnotify' is not available. Possible causes include:
1444Oct 27 20:18:15 localhost bash[1749]: #011- libnotify is not installed
1445Oct 27 20:18:15 localhost bash[1749]: #011- the typelib is provided by a separate package
1446Oct 27 20:18:15 localhost bash[1749]: #011- libnotify was built with introspection disabled
1447Oct 27 20:18:15 localhost bash[1749]: Starting udiskie without notifications.
1448Oct 27 20:18:15 localhost snapd[874]: daemon.go:576: gracefully waiting for running hooks
1449Oct 27 20:18:15 localhost snapd[874]: daemon.go:578: done waiting for running hooks
1450Oct 27 20:18:15 localhost snapd[874]: daemon stop requested to wait for socket activation
1451Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:yaVDRFrontend:init lirc connection on /var/run/lirc/lircd
1452Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:init VDRFrontend with name 'VDR-Frontend and fe_typevdr'
1453Oct 27 20:18:15 localhost kernel: [ 14.319470] FAT-fs (sdc1): Volume was not properly unmounted. Some data may be corrupt. Please run fsck.
1454Oct 27 20:18:15 localhost kernel: [ 14.341696] FAT-fs (sdc3): Volume was not properly unmounted. Some data may be corrupt. Please run fsck.
1455Oct 27 20:18:15 localhost yavdr-frontend[2061]: INFO:pydbus2vdr:VDR Status: running
1456Oct 27 20:18:15 localhost vdr: [1937] dbus2vdr: thread-pool for handling method-calls started
1457Oct 27 20:18:15 localhost systemd[1]: Created slice system-clean\x2dmount\x2dpoint.slice.
1458Oct 27 20:18:15 localhost systemd[1]: Started Clean the /media/vdr/3451-ADE2 mount point.
1459Oct 27 20:18:15 localhost systemd[1]: Started Clean the /media/vdr/327B-9667 mount point.
1460Oct 27 20:18:15 localhost udisksd[879]: Mounted /dev/sdc3 at /media/vdr/3451-ADE2 on behalf of uid 666
1461Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:init SystemdUnit with name: kodi and fe_type: unit
1462Oct 27 20:18:15 localhost bash[1749]: mounted /org/freedesktop/UDisks2/block_devices/sdc3 on /media/vdr/3451-ADE2
1463Oct 27 20:18:15 localhost udisksd[879]: Mounted /dev/sdc1 at /media/vdr/327B-9667 on behalf of uid 666
1464Oct 27 20:18:15 localhost bash[1749]: mounted /org/freedesktop/UDisks2/block_devices/sdc1 on /media/vdr/327B-9667
1465Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:set_unit_name: kodi.service
1466Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:init SystemdUnit with name: firefox and fe_type: app
1467Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:set_unit_name: app@firefox.service
1468Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:init SystemdUnit with name: debian-xterm.desktop and fe_type: app
1469Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:set_unit_name: app@debian\x2dxterm.desktop.service
1470Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:yaVDRFrontend:set_background with options path: /usr/share/yavdr/images/yavdr_logo.png, fill: False
1471Oct 27 20:18:15 localhost vdr: [1936] CAM 2: module ready
1472Oct 27 20:18:15 localhost vdr: [1936] DVBAPI: CaInfo: 1.1 sending CA info
1473Oct 27 20:18:15 localhost vdr: [1936] CAM 2: system ids: FFFF
1474Oct 27 20:18:15 localhost vdr: [1799] CAM 1: ready, master (OSCam)
1475Oct 27 20:18:15 localhost vdr: [1799] CAM 2: ready, slave of CAM 1
1476Oct 27 20:18:15 localhost vdr: [1799] switching to channel 36 S19.2E-1-1089-12080 (RTLplus)
1477Oct 27 20:18:15 localhost vdr: [1799] creating directory /run/shm/vtx
1478Oct 27 20:18:15 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1089-12080
1479Oct 27 20:18:15 localhost systemd[1]: Started Video Disk Recorder.
1480Oct 27 20:18:15 localhost vdr: [1799] [softhddev]SetVolumeDevice: 55
1481Oct 27 20:18:15 localhost vdr: [2112] SVDRP server handler thread started (pid=1799, tid=2112, prio=low)
1482Oct 27 20:18:15 localhost vdr: [2112] SVDRP myVDR opening port 6419/tcp
1483Oct 27 20:18:15 localhost systemd[1]: Started vdr-net-monitor.
1484Oct 27 20:18:15 localhost vdr: [2112] SVDRP myVDR listening on port 6419/tcp
1485Oct 27 20:18:15 localhost vdr: [2108] device 1 receiver thread started (pid=1799, tid=2108, prio=high)
1486Oct 27 20:18:15 localhost vdr: [2111] osdteletext-receiver thread started (pid=1799, tid=2111, prio=high)
1487Oct 27 20:18:15 localhost vdr: [2114] device 1 TS buffer thread started (pid=1799, tid=2114, prio=high)
1488Oct 27 20:18:15 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1489Oct 27 20:18:15 localhost vdr: [2124] SVDRP client handler thread started (pid=1799, tid=2124, prio=low)
1490Oct 27 20:18:15 localhost vdr: [2124] SVDRP myVDR opening port 6419/udp
1491Oct 27 20:18:15 localhost vdr: [2124] SVDRP myVDR listening on port 6419/udp
1492Oct 27 20:18:15 localhost vdr: [2124] SVDRP myVDR > 255.255.255.255:6419 send dgram 'SVDRP:discover name:myVDR port:6419 vdrversion:20400 apiversion:20400 timeout:300'
1493Oct 27 20:18:15 localhost vdr: [1799] OSD size changed to 1920x1080 @ 1
1494Oct 27 20:18:15 localhost vdr: [1799] skindesigner: initializing skin mynew_estuary
1495Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using decimal point ,
1496Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using channel logo path /usr/share/vdr/plugins/skindesigner/logos/
1497Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using icon path /usr/share/vdr/plugins/skindesigner/skins/mynew_estuary/themes/default/
1498Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using skinparts path /usr/share/vdr/plugins/skindesigner/skins/mynew_estuary/themes/default/skinparts/
1499Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using svgtemplate path /usr/share/vdr/plugins/skindesigner/skins/mynew_estuary/svgtemplates/
1500Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using language de_DE
1501Oct 27 20:18:15 localhost mount-notification: event: device_mounted, device: /dev/sdc1, mount_path: /media/vdr/327B-9667
1502Oct 27 20:18:15 localhost mount-notification: event: device_mounted, device: /dev/sdc3, mount_path: /media/vdr/3451-ADE2
1503Oct 27 20:18:15 localhost bash[1749]: ln: Die symbolische Verknüpfung '/srv/vdr/video/327B-9667' konnte nicht angelegt werden: Die Datei existiert bereits
1504Oct 27 20:18:15 localhost vdr: epg2vdr: Error, connecting to database at 'localhost' on port (3306) failed
1505Oct 27 20:18:15 localhost vdr: epg2vdr: Could not access database 'localhost:3306'
1506Oct 27 20:18:15 localhost vdr: epg2vdr: Could not access database 'localhost:3306' (tried to open timers)
1507Oct 27 20:18:15 localhost vdr: epg2vdr: Error, connecting to database at 'localhost' on port (3306) failed
1508Oct 27 20:18:15 localhost bash[1749]: ln: Die symbolische Verknüpfung '/srv/vdr/video/3451-ADE2' konnte nicht angelegt werden: Die Datei existiert bereits
1509Oct 27 20:18:15 localhost vdr: epg2vdr: Could not access database 'localhost:3306'
1510Oct 27 20:18:15 localhost vdr: epg2vdr: Could not access database 'localhost:3306' (tried to open timers)
1511Oct 27 20:18:15 localhost vdr recordings found: mountpoint already exists, aborting
1512Oct 27 20:18:15 localhost vdr recordings found: mountpoint already exists, aborting
1513Oct 27 20:18:15 localhost vdr: [1799] skindesigner: templates successfully validated and parsed
1514Oct 27 20:18:15 localhost vdr: [1799] [softhddev]detached - OpenGl Worker Thread not tried to start
1515Oct 27 20:18:19 localhost vdr: message repeated 31 times: [ [1799] [softhddev]detached - OpenGl Worker Thread not tried to start]
1516Oct 27 20:18:20 localhost vdr: [1907] video directory scanner thread ended (pid=1799, tid=1907)
1517Oct 27 20:18:20 localhost vdr: [1799] [softhddev]detached - OpenGl Worker Thread not tried to start
1518Oct 27 20:18:21 localhost vdr: message repeated 49 times: [ [1799] [softhddev]detached - OpenGl Worker Thread not tried to start]
1519Oct 27 20:18:21 localhost vdr: [1799] skindesigner: templates and images cached
1520Oct 27 20:18:21 localhost vdr: [1799] skindesigner: cached 71 icons - size internal mem 1,79MB, high level mem 0,00MB
1521Oct 27 20:18:21 localhost vdr: [1799] skindesigner: cached 601 logos - size 30943,06MB internal mem
1522Oct 27 20:18:21 localhost vdr: [1799] skindesigner: cached 11 skinparts - size internal mem 21,89MB, high level mem 0,00MB
1523Oct 27 20:18:21 localhost vdr: [1799] skindesigner: templates loaded and caches created - needed 5587 ms
1524Oct 27 20:18:21 localhost vdr: [1799] [softhddev]CreateOsd: left 0, top 0, level 0, using OpenGL OSD support
1525Oct 27 20:18:21 localhost vdr: [1799] [softhddev]detached - OpenGl Worker Thread not tried to start
1526Oct 27 20:18:21 localhost vdr: [1799] [softhddev]OpenGl Thread not started successfully, using Dummy OSD
1527Oct 27 20:18:21 localhost vdr: epg2vdr: Error, connecting to database at 'localhost' on port (3306) failed
1528Oct 27 20:18:21 localhost vdr: epg2vdr: Could not access database 'localhost:3306'
1529Oct 27 20:18:21 localhost vdr: epg2vdr: Could not access database 'localhost:3306' (tried to open timers)
1530Oct 27 20:18:21 localhost vdr: [2223] animator thread thread started (pid=1799, tid=2223, prio=high)
1531Oct 27 20:18:21 localhost yavdr-frontend[2061]: INFO:pydbus2vdr:VDR Status: running
1532Oct 27 20:18:21 localhost vdr: [2224] dbus2vdr: use of deprecated interface: 'List' should be called with the interface 'de.tvdr.vdr.pluginmanager'!
1533Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:softhddevice:False
1534Oct 27 20:18:21 localhost yavdr-frontend[2061]: INFO:softhddevice:use_pasuspend is False
1535Oct 27 20:18:21 localhost avahi-linker[1162]: 2019-10-27 20:18:21,466 INFO Update recdir via dbus: 0 update of recordings triggered
1536Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:could not read /var/cache/vdr/acpiwakeup.time: [Errno 2] No such file or directory: '/var/cache/vdr/acpiwakeup.time'
1537Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:start_t has value StartType.MANUAL
1538Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:attach_on_startup has value auto
1539Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:yaVDRFrontend:set_background with options path: /usr/share/yavdr/images/yavdr_logo.png, fill: False
1540Oct 27 20:18:21 localhost vdr: [2226] video directory scanner thread started (pid=1799, tid=2226, prio=low)
1541Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:user is active: True
1542Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:softhddevice:check_state(): got status code: 912
1543Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:softhddevice:status: softhddevice is detached
1544Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:softhddevice:check_state(): got status code: 912
1545Oct 27 20:18:21 localhost vdr: [2226] video directory scanner thread ended (pid=1799, tid=2226)
1546Oct 27 20:18:21 localhost vdr: video/vdpau: VDPAU API version: 1
1547Oct 27 20:18:21 localhost vdr: video/vdpau: VDPAU information: NVIDIA VDPAU Driver Shared Library 390.116 Sun Jan 27 06:28:58 PST 2019
1548Oct 27 20:18:21 localhost vdr: video/vdpau: highest supported high quality scaling 1
1549Oct 27 20:18:21 localhost vdr: video/vdpau: feature deinterlace temporal supported
1550Oct 27 20:18:21 localhost vdr: video/vdpau: feature deinterlace temporal spatial supported
1551Oct 27 20:18:21 localhost vdr: video/vdpau: attribute skip chroma deinterlace supported
1552Oct 27 20:18:21 localhost vdr: video/vdpau: 4:2:0 chroma format with 4096x4096 supported
1553Oct 27 20:18:21 localhost vdr: video/vdpau: 4:2:2 chroma format with 4096x4096 supported
1554Oct 27 20:18:21 localhost vdr: video/vdpau: 8bit BGRA format with 16384x16384 supported
1555Oct 27 20:18:21 localhost vdr: video/vdpau: 10bit RGBA format with 16384x16384 supported
1556Oct 27 20:18:21 localhost vdr: audio: 'alsa' output module used
1557Oct 27 20:18:21 localhost vdr: audio/alsa: supports pause: yes
1558Oct 27 20:18:21 localhost vdr: [2046] EPGSearch: timer conflict check started
1559Oct 27 20:18:21 localhost vdr: [2046] EPGSearch: timer conflict check finished
1560Oct 27 20:18:22 localhost vdr: audio: 44100Hz supports 1 2 3 4 5 6 7 8 channels
1561Oct 27 20:18:22 localhost vdr: audio: 48000Hz supports 1 2 3 4 5 6 7 8 channels
1562Oct 27 20:18:22 localhost vdr: audio: 192000Hz supports 1 2 3 4 5 6 7 8 channels
1563Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:change_state with command atta and options "-d :0" to attached
1564Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:check_state(): got status code: 910
1565Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:softhddevice successfully attached
1566Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:current PrimaryDevice is softhddevice-openglosd (Index: 2, Number: 2, hasDecoder: True, isPrimary: True)
1567Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:{self.name} is the primary device
1568Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:needed 0.001 s to switch primary device
1569Oct 27 20:18:22 localhost vdr: audio/alsa: using device 'default'
1570Oct 27 20:18:22 localhost vdr: audio/alsa: start delay 336ms
1571Oct 27 20:18:23 localhost /etc/mysql/debian-start[2268]: Upgrading MySQL tables if necessary.
1572Oct 27 20:18:23 localhost vdr: video/vdpau: synced after 31 frames
1573Oct 27 20:18:23 localhost /etc/mysql/debian-start[2271]: /usr/bin/mysql_upgrade: the '--basedir' option is always ignored
1574Oct 27 20:18:23 localhost /etc/mysql/debian-start[2271]: Looking for 'mysql' as: /usr/bin/mysql
1575Oct 27 20:18:23 localhost /etc/mysql/debian-start[2271]: Looking for 'mysqlcheck' as: /usr/bin/mysqlcheck
1576Oct 27 20:18:23 localhost /etc/mysql/debian-start[2271]: This installation of MySQL is already upgraded to 10.1.41-MariaDB, use --force if you still need to run mysql_upgrade
1577Oct 27 20:18:23 localhost /etc/mysql/debian-start[2279]: Checking for insecure root accounts.
1578Oct 27 20:18:23 localhost vdr: video: slow down video, duping frame
1579Oct 27 20:18:23 localhost vdr: video: 5:07:09.955 +105 386 0/\ms 10+7+4 v-buf
1580Oct 27 20:18:23 localhost /etc/mysql/debian-start[2283]: Triggering myisam-recover for all MyISAM tables and aria-recover for all Aria tables
1581Oct 27 20:18:23 localhost systemd[1]: Started MariaDB 10.1.41 database server.
1582Oct 27 20:18:23 localhost systemd[1]: Starting vdr-epg-daemon manages EPG data in a MySQL database...
1583Oct 27 20:18:23 localhost epgd: Set locale to 'de_AT.UTF-8'
1584Oct 27 20:18:23 localhost epgd: Calling sd_notify(READY=1$STATUS=Ready$MAINPID=2292$)
1585Oct 27 20:18:23 localhost systemd[1]: Started vdr-epg-daemon manages EPG data in a MySQL database.
1586Oct 27 20:18:23 localhost epgd: Info: Systemd watchdog not configured, epgd won't be sending keep-alive messages!
1587Oct 27 20:18:23 localhost systemd[1]: Starting epghttpd provides a webinterface for epg data...
1588Oct 27 20:18:23 localhost epgd: Loading uuid from '/etc/epgd/uuid' succeeded [728B3EF7-3164-4835-8CB2-E96D3938FFD2]
1589Oct 27 20:18:23 localhost epgd: Dictionary '/etc/epgd/epg.dat' loaded
1590Oct 27 20:18:23 localhost epgd: Initialize python script '/etc/epgd/recording.py'
1591Oct 27 20:18:23 localhost epghttpd: Set locale to 'de_AT.UTF-8'
1592Oct 27 20:18:23 localhost epghttpd: detected UTF-8
1593Oct 27 20:18:23 localhost epghttpd: Read 29 option from /etc/epgd/epgd.conf
1594Oct 27 20:18:23 localhost epghttpd: Log level is set to (1)
1595Oct 27 20:18:23 localhost epghttpd: Initialize python script '/etc/epgd/recording.py'
1596Oct 27 20:18:23 localhost epgd: Loading plugin: /usr/lib/epgd/plugins/libepgd-epgdata.so
1597Oct 27 20:18:23 localhost epgd: Loading plugin: /usr/lib/epgd/plugins/libepgd-tvm.so
1598Oct 27 20:18:23 localhost epgd: Loading plugin: /usr/lib/epgd/plugins/libepgd-tvsp.so
1599Oct 27 20:18:23 localhost epgd: Read 29 option from /etc/epgd/epgd.conf
1600Oct 27 20:18:23 localhost epgd: Using syslog facility 'user' (8), log level set to (1)
1601Oct 27 20:18:23 localhost epgd: Info: Calling mysql_library_init()
1602Oct 27 20:18:23 localhost epghttpd: Initialize python script '/etc/epgd/recording.py'
1603Oct 27 20:18:23 localhost epgd: Info: Stylesheet '/etc/epgd/epgdata-utf-8.xsl' loaded
1604Oct 27 20:18:23 localhost epgd: Info: Stylesheet '/etc/epgd/tvmovie-utf-8.xsl' loaded
1605Oct 27 20:18:23 localhost epgd: Info: Stylesheet '/etc/epgd/tvsp-utf-8.xsl' loaded
1606Oct 27 20:18:23 localhost epgd: Checking database connection ...
1607Oct 27 20:18:23 localhost epgd: Calling mysql_init(2292)
1608Oct 27 20:18:23 localhost epghttpd: Dictionary '/etc/epgd/epg.dat' loaded
1609Oct 27 20:18:23 localhost epghttpd: Info: Calling mysql_library_init()
1610Oct 27 20:18:23 localhost epghttpd: Connecting to database at 'localhost:3306'
1611Oct 27 20:18:23 localhost epghttpd: Calling mysql_init(2300)
1612Oct 27 20:18:23 localhost epghttpd: SQL client character now 'utf8'
1613Oct 27 20:18:23 localhost epgd: SQL client character now 'utf8'
1614Oct 27 20:18:23 localhost epgd: Checking table structure and indices ...
1615Oct 27 20:18:23 localhost epgd: Checking table 'analyse'
1616Oct 27 20:18:23 localhost epgd: Checking table 'channelmap'
1617Oct 27 20:18:23 localhost epgd: Checking table 'components'
1618Oct 27 20:18:23 localhost epgd: Checking table 'episodes'
1619Oct 27 20:18:23 localhost epghttpd: Calling mysql_init(2300)
1620Oct 27 20:18:23 localhost epgd: Checking table 'events'
1621Oct 27 20:18:23 localhost epghttpd: Starting http server ...
1622Oct 27 20:18:23 localhost epghttpd: Listener at port 9999 established, waiting for connections
1623Oct 27 20:18:23 localhost systemd[1]: Started epghttpd provides a webinterface for epg data.
1624Oct 27 20:18:23 localhost epghttpd: Calling sd_notify(READY=1$STATUS=Ready$MAINPID=2300$)
1625Oct 27 20:18:23 localhost systemd[1]: Reached target Multi-User System.
1626Oct 27 20:18:23 localhost systemd[1]: Reached target Graphical Interface.
1627Oct 27 20:18:23 localhost systemd[1]: Starting Update UTMP about System Runlevel Changes...
1628Oct 27 20:18:23 localhost systemd[1]: Started Stop ureadahead data collection 45s after completed startup.
1629Oct 27 20:18:23 localhost epghttpd: Info: Systemd watchdog not configured, epgd won't be sending keep-alive messages!
1630Oct 27 20:18:23 localhost systemd[1]: Started Update UTMP about System Runlevel Changes.
1631Oct 27 20:18:23 localhost systemd[1]: Startup finished in 4.262s (kernel) + 17.816s (userspace) = 22.078s.
1632Oct 27 20:18:23 localhost epgd: Checking table 'fileref'
1633Oct 27 20:18:23 localhost epgd: Checking table 'imagerefs'
1634Oct 27 20:18:23 localhost epgd: Checking table 'images'
1635Oct 27 20:18:23 localhost epgd: Checking table 'messages'
1636Oct 27 20:18:23 localhost epgd: Checking table 'movie'
1637Oct 27 20:18:23 localhost epgd: Checking table 'movie_actor'
1638Oct 27 20:18:23 localhost epgd: Checking table 'movie_actors'
1639Oct 27 20:18:23 localhost epgd: Checking table 'movie_media'
1640Oct 27 20:18:23 localhost epgd: Checking table 'parameters'
1641Oct 27 20:18:23 localhost epgd: Checking table 'recordingdirs'
1642Oct 27 20:18:23 localhost epgd: Checking table 'recordingimages'
1643Oct 27 20:18:23 localhost epgd: Checking table 'recordinglist'
1644Oct 27 20:18:23 localhost epgd: Checking table 'searchtimers'
1645Oct 27 20:18:23 localhost epgd: Checking table 'series'
1646Oct 27 20:18:23 localhost epgd: Checking table 'series_actor'
1647Oct 27 20:18:23 localhost epgd: Checking table 'series_episode'
1648Oct 27 20:18:23 localhost epgd: Checking table 'series_media'
1649Oct 27 20:18:23 localhost epgd: Checking table 'snapshot'
1650Oct 27 20:18:23 localhost epgd: Checking table 'timers'
1651Oct 27 20:18:23 localhost epgd: Checking table 'timersdone'
1652Oct 27 20:18:23 localhost epgd: Checking table 'useevents'
1653Oct 27 20:18:23 localhost epgd: Checking table 'users'
1654Oct 27 20:18:23 localhost epgd: Checking table 'vdrs'
1655Oct 27 20:18:23 localhost epgd: Closing mysql connection and calling mysql_thread_end(2292)
1656Oct 27 20:18:23 localhost epgd: Checking table structure and indices succeeded
1657Oct 27 20:18:23 localhost epgd: Calling mysql_init(2292)
1658Oct 27 20:18:23 localhost epgd: State now 'init'
1659Oct 27 20:18:23 localhost epgd: Loading '/etc/epgd/channelmap.conf'
1660Oct 27 20:18:23 localhost epgd: 343 channel mappings read.
1661Oct 27 20:18:23 localhost epgd: Calling mysql_init(2292)
1662Oct 27 20:18:23 localhost epgd: Using scraping language de
1663Oct 27 20:18:24 localhost epgd: TVDB scraper connected
1664Oct 27 20:18:25 localhost vdr: scraper2vdr: Got UUID 'EAF88110-7274-4A43-857C-FF31EC9605E1' by epg2vdr
1665Oct 27 20:18:25 localhost vdr: scraper2vdr: Trying to re-connect to database!
1666Oct 27 20:18:25 localhost vdr: scraper2vdr: Calling mysql_init(2057)
1667Oct 27 20:18:25 localhost vdr: scraper2vdr: SQL client character now 'utf8'
1668Oct 27 20:18:25 localhost vdr: scraper2vdr: Connection established successfull!
1669Oct 27 20:18:26 localhost vdr: [2223] animator thread thread ended (pid=1799, tid=2223)
1670Oct 27 20:18:26 localhost epgd: MOVIEDB scraper connected
1671Oct 27 20:18:26 localhost epgd: Scheduled next update in 10 second(s)
1672Oct 27 20:18:26 localhost epgd: State now 'standby'
1673Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43208 client connection accepted
1674Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR > 192.168.192.150:43208 server created
1675Oct 27 20:18:26 localhost epgd: Send 'PLUG epg2vdr STATE standby' to '192.168.192.150:6419'
1676Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43208 lost connection to client
1677Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43208 connection closed
1678Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43208 server destroyed
1679Oct 27 20:18:27 localhost epgd: TCC: Starting timer conflict check
1680Oct 27 20:18:27 localhost epgd: TCC: Finished timer conflict check with (0) conflicts
1681Oct 27 20:18:27 localhost epgd: Checking timers against actual epg and searchtimer settings
1682Oct 27 20:18:27 localhost epgd: Timers check done
1683Oct 27 20:18:27 localhost epgd: AUTOTIMER: Updating searchtimers due to 'search timer changed'
1684Oct 27 20:18:27 localhost epgd: AUTOTIMER: Update done after 0 ms, created (0) timers
1685Oct 27 20:18:28 localhost vdr: scraper2vdr: Got 30409 new scraped Events from Database
1686Oct 27 20:18:28 localhost vdr: scraper2vdr: Loading Movies information from Database...
1687Oct 27 20:18:29 localhost vdr: scraper2vdr: Got 533 new/updated Movies in 1s from Database (new max scrsp: 1572165187)
1688Oct 27 20:18:29 localhost vdr: scraper2vdr: Loading Movies content from Database...
1689Oct 27 20:18:30 localhost vdr: [1799] [softhddev]CreateOsd: left 0, top 0, level 0, using OpenGL OSD support
1690Oct 27 20:18:30 localhost vdr: [1799] [softhddev]Trying to start OpenGL Worker Thread
1691Oct 27 20:18:30 localhost vdr: [2415] oglThread thread started (pid=1799, tid=2415, prio=high)
1692Oct 27 20:18:30 localhost vdr: [2415] [softhddev]OpenGL using display :0
1693Oct 27 20:18:31 localhost vdr: [2415] [softhddev]OpenGL Context initialized
1694Oct 27 20:18:31 localhost vdr: [2415] [softhddev]Shaders initialized
1695Oct 27 20:18:31 localhost vdr: [2415] [softhddev]vdpau interop initialized
1696Oct 27 20:18:31 localhost vdr: [2415] [softhddev]Vertex buffers initialized
1697Oct 27 20:18:31 localhost vdr: [2415] [softhddev]Maximum Pixmap size: 16384x16384px
1698Oct 27 20:18:31 localhost vdr: [1799] [softhddev]OpenGL Worker Thread successfully started
1699Oct 27 20:18:31 localhost vdr: [1799] [softhddev]cOglOsd osdLeft 0 osdTop 0 screenWidth 1920 screenHeight 1080
1700Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1701Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1702Oct 27 20:18:31 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1703Oct 27 20:18:31 localhost vdr: [1799] switching to channel 35 S19.2E-1-1107-17505 (Pro7 MAXX)
1704Oct 27 20:18:31 localhost vdr: [2111] osdteletext-receiver thread ended (pid=1799, tid=2111)
1705Oct 27 20:18:31 localhost vdr: [1799] buffer stats: 0 (0%) used
1706Oct 27 20:18:31 localhost vdr: [2114] device 1 TS buffer thread ended (pid=1799, tid=2114)
1707Oct 27 20:18:31 localhost vdr: [2108] buffer stats: 83096 (1%) used
1708Oct 27 20:18:31 localhost vdr: [2108] device 1 receiver thread ended (pid=1799, tid=2108)
1709Oct 27 20:18:31 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1107-17505
1710Oct 27 20:18:31 localhost vdr: [2417] device 1 receiver thread started (pid=1799, tid=2417, prio=high)
1711Oct 27 20:18:31 localhost vdr: [2418] osdteletext-receiver thread started (pid=1799, tid=2418, prio=high)
1712Oct 27 20:18:31 localhost vdr: [2420] device 1 TS buffer thread started (pid=1799, tid=2420, prio=high)
1713Oct 27 20:18:31 localhost vdr: epg2vdr: Answer 'Epg2Vdr_Timer_Service-v1.0' call with 0 timers, duration was (1 ms)
1714Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1715Oct 27 20:18:31 localhost vdr: [2421] animator thread thread started (pid=1799, tid=2421, prio=high)
1716Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1717Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1718Oct 27 20:18:31 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1719Oct 27 20:18:31 localhost vdr: [1799] switching to channel 35 S19.2E-1-1107-17505 (Pro7 MAXX)
1720Oct 27 20:18:31 localhost vdr: [2418] osdteletext-receiver thread ended (pid=1799, tid=2418)
1721Oct 27 20:18:31 localhost vdr: video: slow down video, duping frame
1722Oct 27 20:18:31 localhost vdr: video: decoder buffer empty, duping frame (5/420) 0 v-buf
1723Oct 27 20:18:31 localhost vdr: video: --:--:--.--- +0 0 0/\ms 0+5+4 v-buf
1724Oct 27 20:18:31 localhost vdr: [1799] buffer stats: 0 (0%) used
1725Oct 27 20:18:31 localhost vdr: [2420] device 1 TS buffer thread ended (pid=1799, tid=2420)
1726Oct 27 20:18:31 localhost vdr: [2417] buffer stats: 0 (0%) used
1727Oct 27 20:18:31 localhost vdr: [2417] device 1 receiver thread ended (pid=1799, tid=2417)
1728Oct 27 20:18:31 localhost vdr: [2424] osdteletext-receiver thread started (pid=1799, tid=2424, prio=high)
1729Oct 27 20:18:31 localhost vdr: [2423] device 1 receiver thread started (pid=1799, tid=2423, prio=high)
1730Oct 27 20:18:31 localhost vdr: [2425] device 1 TS buffer thread started (pid=1799, tid=2425, prio=high)
1731Oct 27 20:18:31 localhost vdr: scraper2vdr: Got 0 new/updated Image information in 2s from Database
1732Oct 27 20:18:31 localhost vdr: scraper2vdr: Loading Series information from Database...
1733Oct 27 20:18:31 localhost vdr: [1799] switching to channel 32 S19.2E-1-1003-13223 (ATV2)
1734Oct 27 20:18:31 localhost vdr: [2424] osdteletext-receiver thread ended (pid=1799, tid=2424)
1735Oct 27 20:18:31 localhost vdr: [1799] buffer stats: 0 (0%) used
1736Oct 27 20:18:31 localhost vdr: [2425] device 1 TS buffer thread ended (pid=1799, tid=2425)
1737Oct 27 20:18:31 localhost vdr: [2423] buffer stats: 50384 (0%) used
1738Oct 27 20:18:31 localhost vdr: [2423] device 1 receiver thread ended (pid=1799, tid=2423)
1739Oct 27 20:18:31 localhost vdr: [1799] CAM 1: assigned to device 1
1740Oct 27 20:18:31 localhost vdr: [2427] device 1 receiver thread started (pid=1799, tid=2427, prio=high)
1741Oct 27 20:18:31 localhost vdr: [2428] device 1 TS buffer thread started (pid=1799, tid=2428, prio=high)
1742Oct 27 20:18:32 localhost vdr: [1799] DVBAPI: 0.0 set CAM decrypt (SID 13223 (0x33A7), caLm 5, HasCaDescriptors 0)
1743Oct 27 20:18:32 localhost vdr: [1799] DVBAPI: 0.0 set CAM decrypt (SID 13223 (0x33A7), caLm 4, HasCaDescriptors 0)
1744Oct 27 20:18:32 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1003-13223
1745Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1746Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1747Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1748Oct 27 20:18:32 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1749Oct 27 20:18:32 localhost vdr: [1799] DVBAPI: 0.0 set CAM decrypt (SID 13223 (0x33A7), caLm 5, HasCaDescriptors 0)
1750Oct 27 20:18:32 localhost vdr: [1799] CAM 1: unassigned from device 1
1751Oct 27 20:18:32 localhost vdr: [1799] switching to channel 31 S19.2E-1-1039-10378 (SR Fernsehen HD)
1752Oct 27 20:18:32 localhost vdr: [2429] osdteletext-receiver thread started (pid=1799, tid=2429, prio=high)
1753Oct 27 20:18:32 localhost vdr: [2429] osdteletext-receiver thread ended (pid=1799, tid=2429)
1754Oct 27 20:18:32 localhost vdr: [1799] buffer stats: 0 (0%) used
1755Oct 27 20:18:32 localhost vdr: [2428] device 1 TS buffer thread ended (pid=1799, tid=2428)
1756Oct 27 20:18:32 localhost vdr: [2427] buffer stats: 0 (0%) used
1757Oct 27 20:18:32 localhost vdr: [2427] device 1 receiver thread ended (pid=1799, tid=2427)
1758Oct 27 20:18:32 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1039-10378
1759Oct 27 20:18:32 localhost vdr: [2433] osdteletext-receiver thread started (pid=1799, tid=2433, prio=high)
1760Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1761Oct 27 20:18:32 localhost vdr: [2432] device 1 receiver thread started (pid=1799, tid=2432, prio=high)
1762Oct 27 20:18:32 localhost vdr: [2434] device 1 TS buffer thread started (pid=1799, tid=2434, prio=high)
1763Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1764Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1765Oct 27 20:18:32 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1766Oct 27 20:18:32 localhost vdr: [1799] switching to channel 30 S19.2E-1-1025-10329 (NDR FS HH HD)
1767Oct 27 20:18:32 localhost vdr: [2433] osdteletext-receiver thread ended (pid=1799, tid=2433)
1768Oct 27 20:18:32 localhost vdr: [1799] buffer stats: 0 (0%) used
1769Oct 27 20:18:32 localhost vdr: [2434] device 1 TS buffer thread ended (pid=1799, tid=2434)
1770Oct 27 20:18:32 localhost vdr: [2432] buffer stats: 0 (0%) used
1771Oct 27 20:18:32 localhost vdr: [2432] device 1 receiver thread ended (pid=1799, tid=2432)
1772Oct 27 20:18:32 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1025-10329
1773Oct 27 20:18:32 localhost vdr: [2436] osdteletext-receiver thread started (pid=1799, tid=2436, prio=high)
1774Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1775Oct 27 20:18:32 localhost vdr: [2435] device 1 receiver thread started (pid=1799, tid=2435, prio=high)
1776Oct 27 20:18:32 localhost vdr: [2437] device 1 TS buffer thread started (pid=1799, tid=2437, prio=high)
1777Oct 27 20:18:33 localhost vdr: audio/alsa: using device 'default'
1778Oct 27 20:18:33 localhost vdr: audio/alsa: start delay 600ms
1779Oct 27 20:18:33 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1780Oct 27 20:18:33 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1781Oct 27 20:18:33 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1782Oct 27 20:18:33 localhost vdr: [1799] switching to channel 29 S19.2E-1-1061-10351 (rbb Berlin HD)
1783Oct 27 20:18:33 localhost vdr: scraper2vdr: Got 783 new/updated Series in 2s from Database (new max scrsp: 1572165173)
1784Oct 27 20:18:33 localhost vdr: scraper2vdr: Loading Series content from Database...
1785Oct 27 20:18:33 localhost vdr: [2436] osdteletext-receiver thread ended (pid=1799, tid=2436)
1786Oct 27 20:18:33 localhost vdr: [1799] buffer stats: 0 (0%) used
1787Oct 27 20:18:33 localhost vdr: [2437] device 1 TS buffer thread ended (pid=1799, tid=2437)
1788Oct 27 20:18:33 localhost vdr: [2435] buffer stats: 149272 (2%) used
1789Oct 27 20:18:33 localhost vdr: [2435] device 1 receiver thread ended (pid=1799, tid=2435)
1790Oct 27 20:18:33 localhost vdr: [2633] device 1 receiver thread started (pid=1799, tid=2633, prio=high)
1791Oct 27 20:18:33 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1061-10351
1792Oct 27 20:18:33 localhost vdr: [2634] osdteletext-receiver thread started (pid=1799, tid=2634, prio=high)
1793Oct 27 20:18:33 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1794Oct 27 20:18:33 localhost vdr: [2635] device 1 TS buffer thread started (pid=1799, tid=2635, prio=high)
1795Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1796Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1797Oct 27 20:18:34 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1798Oct 27 20:18:34 localhost vdr: [1799] switching to channel 28 S19.2E-1-1019-10303 (SWR BW HD)
1799Oct 27 20:18:34 localhost vdr: [2634] osdteletext-receiver thread ended (pid=1799, tid=2634)
1800Oct 27 20:18:34 localhost vdr: [1799] buffer stats: 0 (0%) used
1801Oct 27 20:18:34 localhost vdr: [2635] device 1 TS buffer thread ended (pid=1799, tid=2635)
1802Oct 27 20:18:34 localhost vdr: [2633] buffer stats: 81404 (1%) used
1803Oct 27 20:18:34 localhost vdr: [2633] device 1 receiver thread ended (pid=1799, tid=2633)
1804Oct 27 20:18:34 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1019-10303
1805Oct 27 20:18:34 localhost vdr: [2639] osdteletext-receiver thread started (pid=1799, tid=2639, prio=high)
1806Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1807Oct 27 20:18:34 localhost vdr: [2638] device 1 receiver thread started (pid=1799, tid=2638, prio=high)
1808Oct 27 20:18:34 localhost vdr: [2640] device 1 TS buffer thread started (pid=1799, tid=2640, prio=high)
1809Oct 27 20:18:34 localhost vdr: [softhddev] invalid PES video packet
1810Oct 27 20:18:34 localhost vdr: audio/alsa: using device 'default'
1811Oct 27 20:18:34 localhost vdr: audio/alsa: start delay 600ms
1812Oct 27 20:18:34 localhost vdr: [softhddev] 3 invalid PES video packet(s)
1813Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1814Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1815Oct 27 20:18:34 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1816Oct 27 20:18:34 localhost vdr: [1799] switching to channel 27 S19.2E-1-1101-28111 (WDR Köln)
1817Oct 27 20:18:34 localhost vdr: [2639] osdteletext-receiver thread ended (pid=1799, tid=2639)
1818Oct 27 20:18:34 localhost vdr: [1799] buffer stats: 0 (0%) used
1819Oct 27 20:18:34 localhost vdr: [2640] device 1 TS buffer thread ended (pid=1799, tid=2640)
1820Oct 27 20:18:34 localhost vdr: [2638] buffer stats: 171080 (3%) used
1821Oct 27 20:18:34 localhost vdr: [2638] device 1 receiver thread ended (pid=1799, tid=2638)
1822Oct 27 20:18:34 localhost vdr: [2643] device 1 receiver thread started (pid=1799, tid=2643, prio=high)
1823Oct 27 20:18:34 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1101-28111
1824Oct 27 20:18:34 localhost vdr: [2645] osdteletext-receiver thread started (pid=1799, tid=2645, prio=high)
1825Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1826Oct 27 20:18:34 localhost vdr: [2644] device 1 TS buffer thread started (pid=1799, tid=2644, prio=high)
1827Oct 27 20:18:35 localhost vdr: audio/alsa: using device 'default'
1828Oct 27 20:18:35 localhost vdr: audio/alsa: start delay 600ms
1829Oct 27 20:18:35 localhost vdr: [softhddev] invalid PES video packet
1830Oct 27 20:18:35 localhost vdr: [softhddev] 2 invalid PES video packet(s)
1831Oct 27 20:18:35 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1832Oct 27 20:18:35 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1833Oct 27 20:18:35 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1834Oct 27 20:18:35 localhost vdr: [1799] switching to channel 26 S19.2E-1-1061-10355 (hr-fernsehen HD)
1835Oct 27 20:18:35 localhost vdr: [2645] osdteletext-receiver thread ended (pid=1799, tid=2645)
1836Oct 27 20:18:35 localhost vdr: [1799] buffer stats: 0 (0%) used
1837Oct 27 20:18:35 localhost vdr: [2644] device 1 TS buffer thread ended (pid=1799, tid=2644)
1838Oct 27 20:18:35 localhost vdr: [2643] buffer stats: 70124 (1%) used
1839Oct 27 20:18:35 localhost vdr: [2643] device 1 receiver thread ended (pid=1799, tid=2643)
1840Oct 27 20:18:35 localhost vdr: [2648] device 1 receiver thread started (pid=1799, tid=2648, prio=high)
1841Oct 27 20:18:35 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1061-10355
1842Oct 27 20:18:35 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1843Oct 27 20:18:35 localhost vdr: [2649] device 1 TS buffer thread started (pid=1799, tid=2649, prio=high)
1844Oct 27 20:18:35 localhost vdr: [2650] osdteletext-receiver thread started (pid=1799, tid=2650, prio=high)
1845Oct 27 20:18:36 localhost vdr: audio/alsa: using device 'default'
1846Oct 27 20:18:36 localhost vdr: audio/alsa: start delay 600ms
1847Oct 27 20:18:36 localhost epgd: State now 'busy (events)'
1848Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43210 client connection accepted
1849Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR > 192.168.192.150:43210 server created
1850Oct 27 20:18:36 localhost epgd: Send 'PLUG epg2vdr STATE busy (events)' to '192.168.192.150:6419'
1851Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43210 lost connection to client
1852Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43210 connection closed
1853Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43210 server destroyed
1854Oct 27 20:18:36 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1855Oct 27 20:18:36 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1856Oct 27 20:18:36 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1857Oct 27 20:18:36 localhost vdr: [1799] switching to channel 25 S19.2E-1-1061-10353 (MDR S-Anhalt HD)
1858Oct 27 20:18:36 localhost vdr: [2650] osdteletext-receiver thread ended (pid=1799, tid=2650)
1859Oct 27 20:18:36 localhost vdr: [1799] buffer stats: 0 (0%) used
1860Oct 27 20:18:37 localhost vdr: [2649] device 1 TS buffer thread ended (pid=1799, tid=2649)
1861Oct 27 20:18:37 localhost vdr: [2648] buffer stats: 214132 (4%) used
1862Oct 27 20:18:37 localhost vdr: [2648] device 1 receiver thread ended (pid=1799, tid=2648)
1863Oct 27 20:18:37 localhost vdr: [2655] device 1 receiver thread started (pid=1799, tid=2655, prio=high)
1864Oct 27 20:18:37 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1061-10353
1865Oct 27 20:18:37 localhost vdr: [2657] osdteletext-receiver thread started (pid=1799, tid=2657, prio=high)
1866Oct 27 20:18:37 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1867Oct 27 20:18:37 localhost vdr: [2656] device 1 TS buffer thread started (pid=1799, tid=2656, prio=high)
1868Oct 27 20:18:37 localhost vdr: audio/alsa: using device 'default'
1869Oct 27 20:18:37 localhost vdr: audio/alsa: start delay 600ms
1870Oct 27 20:18:37 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1871Oct 27 20:18:37 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1872Oct 27 20:18:37 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1873Oct 27 20:18:37 localhost vdr: [1799] switching to channel 24 S19.2E-133-5-772 (TLC)
1874Oct 27 20:18:37 localhost vdr: [2657] osdteletext-receiver thread ended (pid=1799, tid=2657)
1875Oct 27 20:18:37 localhost vdr: [1799] buffer stats: 0 (0%) used
1876Oct 27 20:18:37 localhost vdr: [2656] device 1 TS buffer thread ended (pid=1799, tid=2656)
1877Oct 27 20:18:37 localhost vdr: [2655] buffer stats: 131412 (2%) used
1878Oct 27 20:18:37 localhost vdr: [2655] device 1 receiver thread ended (pid=1799, tid=2655)
1879Oct 27 20:18:37 localhost vdr: [2660] device 1 receiver thread started (pid=1799, tid=2660, prio=high)
1880Oct 27 20:18:37 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-133-5-772
1881Oct 27 20:18:37 localhost vdr: [2661] device 1 TS buffer thread started (pid=1799, tid=2661, prio=high)
1882Oct 27 20:18:37 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1883Oct 27 20:18:37 localhost vdr: [2662] osdteletext-receiver thread started (pid=1799, tid=2662, prio=high)
1884Oct 27 20:18:38 localhost vdr: scraper2vdr: Got 3630 new/updated Episodes and 2267 new/updated Image information (including 1794 possible not available season poster) in 5s from Database
1885Oct 27 20:18:38 localhost vdr: scraper2vdr: Loading Image content from Database...
1886Oct 27 20:18:38 localhost vdr: audio/alsa: using device 'default'
1887Oct 27 20:18:38 localhost vdr: audio/alsa: start delay 600ms
1888Oct 27 20:18:38 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1889Oct 27 20:18:38 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1890Oct 27 20:18:38 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1891Oct 27 20:18:38 localhost vdr: [1799] switching to channel 23 S19.2E-1-1115-13106 (sixx Austria)
1892Oct 27 20:18:38 localhost vdr: [2662] osdteletext-receiver thread ended (pid=1799, tid=2662)
1893Oct 27 20:18:38 localhost vdr: [1799] buffer stats: 0 (0%) used
1894Oct 27 20:18:38 localhost vdr: [2661] device 1 TS buffer thread ended (pid=1799, tid=2661)
1895Oct 27 20:18:38 localhost vdr: [2660] buffer stats: 51324 (0%) used
1896Oct 27 20:18:38 localhost vdr: [2660] device 1 receiver thread ended (pid=1799, tid=2660)
1897Oct 27 20:18:38 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1115-13106
1898Oct 27 20:18:38 localhost vdr: [2667] osdteletext-receiver thread started (pid=1799, tid=2667, prio=high)
1899Oct 27 20:18:38 localhost vdr: [2666] device 1 receiver thread started (pid=1799, tid=2666, prio=high)
1900Oct 27 20:18:38 localhost vdr: [2668] device 1 TS buffer thread started (pid=1799, tid=2668, prio=high)
1901Oct 27 20:18:38 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1902Oct 27 20:18:38 localhost epgd: Starting cleanup of events
1903Oct 27 20:18:38 localhost epgd: Delete fileref [substr(name,1,8) <= '20191026' and source = 'epgdata']
1904Oct 27 20:18:38 localhost epgd: Delete events [starttime+duration < 1572182318]
1905Oct 27 20:18:39 localhost vdr: audio/alsa: using device 'default'
1906Oct 27 20:18:39 localhost vdr: audio/alsa: start delay 600ms
1907Oct 27 20:18:39 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1908Oct 27 20:18:39 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1909Oct 27 20:18:39 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1910Oct 27 20:18:39 localhost vdr: [1799] switching to channel 22 S19.2E-133-33-51 (TELE 5)
1911Oct 27 20:18:39 localhost vdr: [2667] osdteletext-receiver thread ended (pid=1799, tid=2667)
1912Oct 27 20:18:39 localhost vdr: [1799] buffer stats: 0 (0%) used
1913Oct 27 20:18:39 localhost vdr: [2668] device 1 TS buffer thread ended (pid=1799, tid=2668)
1914Oct 27 20:18:39 localhost vdr: [2666] buffer stats: 42112 (0%) used
1915Oct 27 20:18:39 localhost vdr: [2666] device 1 receiver thread ended (pid=1799, tid=2666)
1916Oct 27 20:18:39 localhost vdr: [2682] device 1 receiver thread started (pid=1799, tid=2682, prio=high)
1917Oct 27 20:18:39 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-133-33-51
1918Oct 27 20:18:39 localhost vdr: [2683] device 1 TS buffer thread started (pid=1799, tid=2683, prio=high)
1919Oct 27 20:18:39 localhost vdr: [2684] osdteletext-receiver thread started (pid=1799, tid=2684, prio=high)
1920Oct 27 20:18:39 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1921Oct 27 20:18:40 localhost vdr: audio/alsa: using device 'default'
1922Oct 27 20:18:40 localhost vdr: audio/alsa: start delay 600ms
1923Oct 27 20:18:40 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1924Oct 27 20:18:40 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1925Oct 27 20:18:40 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1926Oct 27 20:18:40 localhost vdr: [1799] switching to channel 21 S19.2E-133-5-764 (ANIXE+)
1927Oct 27 20:18:40 localhost vdr: [2684] osdteletext-receiver thread ended (pid=1799, tid=2684)
1928Oct 27 20:18:40 localhost vdr: [1799] buffer stats: 0 (0%) used
1929Oct 27 20:18:40 localhost vdr: [2683] device 1 TS buffer thread ended (pid=1799, tid=2683)
1930Oct 27 20:18:40 localhost vdr: [2682] buffer stats: 30456 (0%) used
1931Oct 27 20:18:40 localhost vdr: [2682] device 1 receiver thread ended (pid=1799, tid=2682)
1932Oct 27 20:18:40 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1933Oct 27 20:18:40 localhost vdr: [2688] device 1 receiver thread started (pid=1799, tid=2688, prio=high)
1934Oct 27 20:18:40 localhost vdr: [2689] device 1 TS buffer thread started (pid=1799, tid=2689, prio=high)
1935Oct 27 20:18:40 localhost vdr: audio/alsa: using device 'default'
1936Oct 27 20:18:40 localhost vdr: audio/alsa: start delay 600ms
1937Oct 27 20:18:40 localhost epgd: Delete useevents [cnt_starttime+cnt_duration < 1572182318]
1938Oct 27 20:18:40 localhost epgd: SQL-Error in 'delete from useevents where cnt_starttime+cnt_duration < 1572182318' - Index useevents is corrupted (1712)
1939Oct 27 20:18:40 localhost epgd: SQL-Error in 'deleteWhere()' - Index useevents is corrupted (1712) '' [delete from useevents where cnt_starttime+cnt_duration < 1572182318]
1940Oct 27 20:18:41 localhost epgd: Cleanup of events finished
1941Oct 27 20:18:41 localhost epgd: Starting cleanup of failed timer actions, older than 10 days
1942Oct 27 20:18:41 localhost epgd: Cleanup of timer actions finished
1943Oct 27 20:18:41 localhost epgd: Calling sd_notify(STATUS=Busy, started Update)
1944Oct 27 20:18:41 localhost epgd: EPG Update started
1945Oct 27 20:18:41 localhost epgd: Updating 'tvm' day today+0 now
1946Oct 27 20:18:41 localhost epgd: Checking tvm id 1
1947Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1948Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1949Oct 27 20:18:41 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1950Oct 27 20:18:41 localhost vdr: [1799] switching to channel 20 S19.2E-1-1019-10302 (arte HD)
1951Oct 27 20:18:41 localhost vdr: [2689] device 1 TS buffer thread ended (pid=1799, tid=2689)
1952Oct 27 20:18:41 localhost vdr: [2688] buffer stats: 43240 (0%) used
1953Oct 27 20:18:41 localhost vdr: [2688] device 1 receiver thread ended (pid=1799, tid=2688)
1954Oct 27 20:18:41 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1019-10302
1955Oct 27 20:18:41 localhost vdr: [2694] device 1 receiver thread started (pid=1799, tid=2694, prio=high)
1956Oct 27 20:18:41 localhost vdr: [2696] device 1 TS buffer thread started (pid=1799, tid=2696, prio=high)
1957Oct 27 20:18:41 localhost vdr: [2695] osdteletext-receiver thread started (pid=1799, tid=2695, prio=high)
1958Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1959Oct 27 20:18:41 localhost vdr: audio/alsa: using device 'default'
1960Oct 27 20:18:41 localhost vdr: audio/alsa: start delay 600ms
1961Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1962Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1963Oct 27 20:18:41 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1964Oct 27 20:18:41 localhost vdr: [1799] switching to channel 20 S19.2E-1-1019-10302 (arte HD)
1965Oct 27 20:18:41 localhost vdr: [2695] osdteletext-receiver thread ended (pid=1799, tid=2695)
1966Oct 27 20:18:41 localhost vdr: [1799] buffer stats: 0 (0%) used
1967Oct 27 20:18:41 localhost vdr: [2696] device 1 TS buffer thread ended (pid=1799, tid=2696)
1968Oct 27 20:18:41 localhost vdr: [2694] buffer stats: 153972 (2%) used
1969Oct 27 20:18:41 localhost vdr: [2694] device 1 receiver thread ended (pid=1799, tid=2694)
1970Oct 27 20:18:41 localhost vdr: [2699] osdteletext-receiver thread started (pid=1799, tid=2699, prio=high)
1971Oct 27 20:18:41 localhost vdr: [2698] device 1 receiver thread started (pid=1799, tid=2698, prio=high)
1972Oct 27 20:18:41 localhost vdr: [2700] device 1 TS buffer thread started (pid=1799, tid=2700, prio=high)
1973Oct 27 20:18:41 localhost vdr: [1799] switching to channel 19 S19.2E-133-33-63 (DMAX)
1974Oct 27 20:18:41 localhost vdr: [2699] osdteletext-receiver thread ended (pid=1799, tid=2699)
1975Oct 27 20:18:41 localhost vdr: [1799] buffer stats: 0 (0%) used
1976Oct 27 20:18:42 localhost vdr: [2700] device 1 TS buffer thread ended (pid=1799, tid=2700)
1977Oct 27 20:18:42 localhost vdr: [2698] buffer stats: 160552 (3%) used
1978Oct 27 20:18:42 localhost vdr: [2698] device 1 receiver thread ended (pid=1799, tid=2698)
1979Oct 27 20:18:42 localhost vdr: [2702] device 1 receiver thread started (pid=1799, tid=2702, prio=high)
1980Oct 27 20:18:42 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-133-33-63
1981Oct 27 20:18:42 localhost vdr: [2704] osdteletext-receiver thread started (pid=1799, tid=2704, prio=high)
1982Oct 27 20:18:42 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1983Oct 27 20:18:42 localhost vdr: [2703] device 1 TS buffer thread started (pid=1799, tid=2703, prio=high)
1984Oct 27 20:18:42 localhost vdr: [1799] [softhddev]SetPlayMode: 0
1985Oct 27 20:18:42 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
1986Oct 27 20:18:42 localhost vdr: [1799] [softhddev]GetSpuDecoder:
1987Oct 27 20:18:42 localhost vdr: [1799] switching to channel 18 S19.2E-1-1089-12040 (SUPER RTL)
1988Oct 27 20:18:42 localhost vdr: [2704] osdteletext-receiver thread ended (pid=1799, tid=2704)
1989Oct 27 20:18:42 localhost vdr: [1799] buffer stats: 0 (0%) used
1990Oct 27 20:18:42 localhost vdr: [2703] device 1 TS buffer thread ended (pid=1799, tid=2703)
1991Oct 27 20:18:42 localhost vdr: [2702] buffer stats: 0 (0%) used
1992Oct 27 20:18:42 localhost vdr: [2702] device 1 receiver thread ended (pid=1799, tid=2702)
1993Oct 27 20:18:42 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1089-12040
1994Oct 27 20:18:42 localhost vdr: [2707] osdteletext-receiver thread started (pid=1799, tid=2707, prio=high)
1995Oct 27 20:18:42 localhost vdr: [2706] device 1 receiver thread started (pid=1799, tid=2706, prio=high)
1996Oct 27 20:18:42 localhost vdr: [2708] device 1 TS buffer thread started (pid=1799, tid=2708, prio=high)
1997Oct 27 20:18:42 localhost vdr: [1799] [softhddev]SetPlayMode: 1
1998Oct 27 20:18:42 localhost vdr: scraper2vdr: Got 528 new/updated Images (found 1739 not available images) in 4s from Database
1999Oct 27 20:18:42 localhost epgd: Checking tvm id 11
2000Oct 27 20:18:42 localhost systemd-timesyncd[762]: Synchronized to time server 91.189.89.199:123 (ntp.ubuntu.com).
2001Oct 27 20:18:42 localhost epgd: Checking tvm id 111
2002Oct 27 20:18:42 localhost epgd: Checking tvm id 12
2003Oct 27 20:18:42 localhost vdr: audio/alsa: using device 'default'
2004Oct 27 20:18:42 localhost vdr: audio/alsa: start delay 600ms
2005Oct 27 20:18:43 localhost vdr: [softhddev] invalid PES video packet
2006Oct 27 20:18:43 localhost vdr: [softhddev] 2 invalid PES video packet(s)
2007Oct 27 20:18:43 localhost epgd: Checking tvm id 129
2008Oct 27 20:18:43 localhost epgd: Checking tvm id 13
2009Oct 27 20:18:43 localhost vdr: [1799] [softhddev]SetPlayMode: 0
2010Oct 27 20:18:43 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
2011Oct 27 20:18:43 localhost vdr: [1799] [softhddev]GetSpuDecoder:
2012Oct 27 20:18:43 localhost vdr: [1799] switching to channel 17 S19.2E-1-1091-28805 (VOX Austria)
2013Oct 27 20:18:43 localhost vdr: [2707] osdteletext-receiver thread ended (pid=1799, tid=2707)
2014Oct 27 20:18:43 localhost vdr: [1799] buffer stats: 0 (0%) used
2015Oct 27 20:18:43 localhost vdr: [2708] device 1 TS buffer thread ended (pid=1799, tid=2708)
2016Oct 27 20:18:43 localhost vdr: [2706] buffer stats: 55272 (1%) used
2017Oct 27 20:18:43 localhost vdr: [2706] device 1 receiver thread ended (pid=1799, tid=2706)
2018Oct 27 20:18:43 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1091-28805
2019Oct 27 20:18:43 localhost vdr: [2713] osdteletext-receiver thread started (pid=1799, tid=2713, prio=high)
2020Oct 27 20:18:43 localhost vdr: [1799] [softhddev]SetPlayMode: 1
2021Oct 27 20:18:43 localhost vdr: [2712] device 1 receiver thread started (pid=1799, tid=2712, prio=high)
2022Oct 27 20:18:43 localhost vdr: [2714] device 1 TS buffer thread started (pid=1799, tid=2714, prio=high)
2023Oct 27 20:18:43 localhost epgd: Checking tvm id 137
2024Oct 27 20:18:44 localhost epgd: Checking tvm id 14
2025Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Die_glorreichen_Sieben/2019-09-16.01.48.1-0.rec/marks
2026Oct 27 20:18:44 localhost vdr: audio/alsa: using device 'default'
2027Oct 27 20:18:44 localhost vdr: audio/alsa: start delay 600ms
2028Oct 27 20:18:44 localhost epgd: Checking tvm id 16
2029Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Pirates_of_the_Caribbean_4_–_Fremde_Gezeiten/2019-09-15.22.24.1-0.rec/marks
2030Oct 27 20:18:44 localhost epgd: Checking tvm id 168
2031Oct 27 20:18:44 localhost epgd: Checking tvm id 17
2032Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Baumschlager/2019-06-01.01.01.1-0.rec/marks
2033Oct 27 20:18:44 localhost epgd: Checking tvm id 2
2034Oct 27 20:18:44 localhost epgd: Checking tvm id 269
2035Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Lone_Ranger/2019-03-24.02.44.1-0.rec/marks
2036Oct 27 20:18:44 localhost epgd: Checking tvm id 294
2037Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/scobel/scobel/2019-01-17.20.58.6-0.rec/marks
2038Oct 27 20:18:44 localhost epgd: Checking tvm id 3
2039Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Gesund_durch_Fasten/Gesund_durch_Fasten/2019-01-17.20.13.6-0.rec/marks
2040Oct 27 20:18:44 localhost epgd: Checking tvm id 30
2041Oct 27 20:18:44 localhost epgd: Checking tvm id 301
2042Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Zoomania/2018-12-26.18.08.1-0.rec/marks
2043Oct 27 20:18:44 localhost epgd: Checking tvm id 31
2044Oct 27 20:18:45 localhost vdr: [1799] [softhddev]SetPlayMode: 0
2045Oct 27 20:18:45 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
2046Oct 27 20:18:45 localhost vdr: [1799] [softhddev]GetSpuDecoder:
2047Oct 27 20:18:45 localhost vdr: [1799] switching to channel 16 S19.2E-1-1091-28810 (RTL2 Austria)
2048Oct 27 20:18:45 localhost vdr: [2713] osdteletext-receiver thread ended (pid=1799, tid=2713)
2049Oct 27 20:18:45 localhost vdr: [1799] buffer stats: 0 (0%) used
2050Oct 27 20:18:45 localhost epgd: Checking tvm id 314
2051Oct 27 20:18:45 localhost vdr: [2714] device 1 TS buffer thread ended (pid=1799, tid=2714)
2052Oct 27 20:18:45 localhost vdr: [2712] buffer stats: 47940 (0%) used
2053Oct 27 20:18:45 localhost vdr: [2712] device 1 receiver thread ended (pid=1799, tid=2712)
2054Oct 27 20:18:45 localhost vdr: [2720] device 1 receiver thread started (pid=1799, tid=2720, prio=high)
2055Oct 27 20:18:45 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1091-28810
2056Oct 27 20:18:45 localhost vdr: [2722] device 1 TS buffer thread started (pid=1799, tid=2722, prio=high)
2057Oct 27 20:18:45 localhost vdr: [2721] osdteletext-receiver thread started (pid=1799, tid=2721, prio=high)
2058Oct 27 20:18:45 localhost vdr: [1799] [softhddev]SetPlayMode: 1
2059Oct 27 20:18:45 localhost epgd: Checking tvm id 316
2060Oct 27 20:18:45 localhost vdr: audio/alsa: using device 'default'
2061Oct 27 20:18:45 localhost vdr: audio/alsa: start delay 600ms
2062Oct 27 20:18:45 localhost epgd: Checking tvm id 318
2063Oct 27 20:18:45 localhost epgd: Checking tvm id 38
2064Oct 27 20:18:45 localhost epgd: Checking tvm id 39
2065Oct 27 20:18:45 localhost epgd: Checking tvm id 4
2066Oct 27 20:18:45 localhost epgd: Checking tvm id 41
2067Oct 27 20:18:45 localhost epgd: Checking tvm id 427
2068Oct 27 20:18:45 localhost epgd: Checking tvm id 43
2069Oct 27 20:18:45 localhost epgd: Checking tvm id 430
2070Oct 27 20:18:45 localhost epgd: Checking tvm id 436
2071Oct 27 20:18:45 localhost epgd: Checking tvm id 437
2072Oct 27 20:18:45 localhost epgd: Checking tvm id 445
2073Oct 27 20:18:46 localhost epgd: Checking tvm id 447
2074Oct 27 20:18:46 localhost epgd: Checking tvm id 451
2075Oct 27 20:18:46 localhost vdr: video: decoder buffer empty, duping frame (639/8) 2 v-buf
2076Oct 27 20:18:46 localhost vdr: video: slow down video, duping frame
2077Oct 27 20:18:46 localhost vdr: video: 13:54:02.842 +106 520 0/\ms 17+7+4 v-buf
2078Oct 27 20:18:46 localhost vdr: video/vdpau: synced after 56 frames
2079Oct 27 20:18:46 localhost epgd: Checking tvm id 459
2080Oct 27 20:18:47 localhost epgd: Checking tvm id 46
2081Oct 27 20:18:47 localhost epgd: Checking tvm id 47
2082Oct 27 20:18:47 localhost epgd: Checking tvm id 48
2083Oct 27 20:18:47 localhost epgd: Checking tvm id 5
2084Oct 27 20:18:47 localhost vdr: [1799] [softhddev]SetPlayMode: 0
2085Oct 27 20:18:47 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
2086Oct 27 20:18:47 localhost vdr: [1799] [softhddev]GetSpuDecoder:
2087Oct 27 20:18:47 localhost vdr: [1799] switching to channel 15 S19.2E-1-1082-20004 (Kabel 1 Austria)
2088Oct 27 20:18:47 localhost vdr: [2721] osdteletext-receiver thread ended (pid=1799, tid=2721)
2089Oct 27 20:18:47 localhost vdr: [1799] buffer stats: 0 (0%) used
2090Oct 27 20:18:47 localhost epgd: Checking tvm id 52
2091Oct 27 20:18:47 localhost vdr: [2722] device 1 TS buffer thread ended (pid=1799, tid=2722)
2092Oct 27 20:18:47 localhost vdr: [2720] buffer stats: 30832 (0%) used
2093Oct 27 20:18:47 localhost vdr: [2720] device 1 receiver thread ended (pid=1799, tid=2720)
2094Oct 27 20:18:47 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1082-20004
2095Oct 27 20:18:47 localhost vdr: [2730] osdteletext-receiver thread started (pid=1799, tid=2730, prio=high)
2096Oct 27 20:18:47 localhost vdr: [1799] [softhddev]SetPlayMode: 1
2097Oct 27 20:18:47 localhost vdr: [2729] device 1 receiver thread started (pid=1799, tid=2729, prio=high)
2098Oct 27 20:18:47 localhost vdr: [2731] device 1 TS buffer thread started (pid=1799, tid=2731, prio=high)
2099Oct 27 20:18:47 localhost epgd: Checking tvm id 55
2100Oct 27 20:18:48 localhost epgd: Checking tvm id 57
2101Oct 27 20:18:48 localhost epgd: Checking tvm id 6
2102Oct 27 20:18:48 localhost vdr: [softhddev] invalid PES video packet
2103Oct 27 20:18:48 localhost vdr: [softhddev] 2 invalid PES video packet(s)
2104Oct 27 20:18:48 localhost vdr: audio/alsa: using device 'default'
2105Oct 27 20:18:48 localhost vdr: audio/alsa: start delay 600ms
2106Oct 27 20:18:48 localhost vdr: video: slow down video, duping frame
2107Oct 27 20:18:48 localhost vdr: video: decoder buffer empty, duping frame (644/86) 0 v-buf
2108Oct 27 20:18:48 localhost vdr: video: --:--:--.--- +0 0 0/\ms 0+5+4 v-buf
2109Oct 27 20:18:48 localhost epgd: Checking tvm id 60
2110Oct 27 20:18:48 localhost epgd: Checking tvm id 69
2111Oct 27 20:18:48 localhost vdr: [1799] [softhddev]SetPlayMode: 0
2112Oct 27 20:18:48 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
2113Oct 27 20:18:48 localhost vdr: [1799] [softhddev]GetSpuDecoder:
2114Oct 27 20:18:48 localhost vdr: [1799] switching to channel 14 S19.2E-1-1082-20002 (ProSieben Austria)
2115Oct 27 20:18:48 localhost vdr: [2730] osdteletext-receiver thread ended (pid=1799, tid=2730)
2116Oct 27 20:18:48 localhost vdr: [1799] buffer stats: 0 (0%) used
2117Oct 27 20:18:48 localhost epgd: Checking tvm id 7
2118Oct 27 20:18:48 localhost epgd: Checking tvm id 76
2119Oct 27 20:18:48 localhost vdr: [2731] device 1 TS buffer thread ended (pid=1799, tid=2731)
2120Oct 27 20:18:48 localhost vdr: [2729] buffer stats: 90428 (1%) used
2121Oct 27 20:18:48 localhost vdr: [2729] device 1 receiver thread ended (pid=1799, tid=2729)
2122Oct 27 20:18:48 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1082-20002
2123Oct 27 20:18:48 localhost vdr: [2736] osdteletext-receiver thread started (pid=1799, tid=2736, prio=high)
2124Oct 27 20:18:48 localhost vdr: [2735] device 1 receiver thread started (pid=1799, tid=2735, prio=high)
2125Oct 27 20:18:48 localhost vdr: [2737] device 1 TS buffer thread started (pid=1799, tid=2737, prio=high)
2126Oct 27 20:18:48 localhost vdr: [1799] [softhddev]SetPlayMode: 1
2127Oct 27 20:18:48 localhost epgd: Checking tvm id 8
2128Oct 27 20:18:48 localhost epgd: Checking tvm id 9
2129Oct 27 20:18:48 localhost vdr: audio/alsa: using device 'default'
2130Oct 27 20:18:48 localhost vdr: audio/alsa: start delay 600ms
2131Oct 27 20:18:48 localhost epgd: Updating 'tvsp' day today+0 now
2132Oct 27 20:18:49 localhost epgd: Downloaded '2NEO' for 2019-10-27 not changed, skipping.
2133Oct 27 20:18:49 localhost epgd: Downloaded '3SAT' for 2019-10-27 with (93373) Bytes, changed since last load.
2134Oct 27 20:18:49 localhost epgd: Downloaded 'ALPHA' for 2019-10-27 not changed, skipping.
2135Oct 27 20:18:49 localhost vdr: audio/alsa: using device 'default'
2136Oct 27 20:18:49 localhost vdr: audio/alsa: start delay 600ms
2137Oct 27 20:18:49 localhost epgd: Downloaded 'ANIXE' for 2019-10-27 not changed, skipping.
2138Oct 27 20:18:49 localhost epgd: Downloaded 'ARD' for 2019-10-27 with (77880) Bytes, changed since last load.
2139Oct 27 20:18:49 localhost epgd: Downloaded 'ARTE' for 2019-10-27 with (95330) Bytes, changed since last load.
2140Oct 27 20:18:50 localhost vdr: video: decoder buffer empty, duping frame (687/8) 3 v-buf
2141Oct 27 20:18:50 localhost vdr: video: slow down video, duping frame
2142Oct 27 20:18:50 localhost vdr: video: 24:13:19.359 +112 614 0/\ms 27+7+4 v-buf
2143Oct 27 20:18:50 localhost vdr: video/vdpau: synced after 66 frames
2144Oct 27 20:18:50 localhost vdr: [1799] [softhddev]SetPlayMode: 0
2145Oct 27 20:18:50 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
2146Oct 27 20:18:50 localhost vdr: [1799] [softhddev]GetSpuDecoder:
2147Oct 27 20:18:50 localhost vdr: [1799] switching to channel 13 S19.2E-1-1091-28800 (RTL Austria)
2148Oct 27 20:18:50 localhost vdr: [2736] osdteletext-receiver thread ended (pid=1799, tid=2736)
2149Oct 27 20:18:50 localhost vdr: [1799] buffer stats: 0 (0%) used
2150Oct 27 20:18:51 localhost vdr: [2737] device 1 TS buffer thread ended (pid=1799, tid=2737)
2151Oct 27 20:18:51 localhost vdr: [2735] buffer stats: 29140 (0%) used
2152Oct 27 20:18:51 localhost vdr: [2735] device 1 receiver thread ended (pid=1799, tid=2735)
2153Oct 27 20:18:51 localhost vdr: [2747] device 1 receiver thread started (pid=1799, tid=2747, prio=high)
2154Oct 27 20:18:51 localhost vdr: [2748] device 1 TS buffer thread started (pid=1799, tid=2748, prio=high)
2155Oct 27 20:18:51 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1091-28800
2156Oct 27 20:18:51 localhost vdr: [2749] osdteletext-receiver thread started (pid=1799, tid=2749, prio=high)
2157Oct 27 20:18:51 localhost vdr: [1799] [softhddev]SetPlayMode: 1
2158Oct 27 20:18:51 localhost epgd: Downloaded 'ATV' for 2019-10-27 with (34301) Bytes, changed since last load.
2159Oct 27 20:18:51 localhost vdr: audio/alsa: using device 'default'
2160Oct 27 20:18:51 localhost vdr: audio/alsa: start delay 600ms
2161Oct 27 20:18:51 localhost vdr: audio/alsa: using device 'default'
2162Oct 27 20:18:51 localhost vdr: audio/alsa: start delay 600ms
2163Oct 27 20:18:52 localhost epgd: Downloaded 'ATV2' for 2019-10-27 not changed, skipping.
2164Oct 27 20:18:52 localhost vdr: [1799] [softhddev]SetPlayMode: 0
2165Oct 27 20:18:52 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
2166Oct 27 20:18:52 localhost vdr: [1799] [softhddev]GetSpuDecoder:
2167Oct 27 20:18:52 localhost vdr: [1799] switching to channel 12 S19.2E-1-1082-20005 (SAT.1 A)
2168Oct 27 20:18:52 localhost vdr: [2749] osdteletext-receiver thread ended (pid=1799, tid=2749)
2169Oct 27 20:18:52 localhost vdr: [1799] buffer stats: 0 (0%) used
2170Oct 27 20:18:52 localhost vdr: [2748] device 1 TS buffer thread ended (pid=1799, tid=2748)
2171Oct 27 20:18:52 localhost vdr: [2747] buffer stats: 93624 (1%) used
2172Oct 27 20:18:52 localhost vdr: [2747] device 1 receiver thread ended (pid=1799, tid=2747)
2173Oct 27 20:18:52 localhost vdr: [2755] device 1 receiver thread started (pid=1799, tid=2755, prio=high)
2174Oct 27 20:18:52 localhost vdr: [2756] device 1 TS buffer thread started (pid=1799, tid=2756, prio=high)
2175Oct 27 20:18:52 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1082-20005
2176Oct 27 20:18:52 localhost vdr: [2757] osdteletext-receiver thread started (pid=1799, tid=2757, prio=high)
2177Oct 27 20:18:52 localhost vdr: [1799] [softhddev]SetPlayMode: 1
2178Oct 27 20:18:52 localhost vdr: video: slow down video, duping frame
2179Oct 27 20:18:52 localhost vdr: video: decoder buffer empty, duping frame (692/18) 0 v-buf
2180Oct 27 20:18:52 localhost vdr: video: --:--:--.--- +0 0 0/\ms 0+5+4 v-buf
2181Oct 27 20:18:52 localhost epgd: Downloaded 'BBC' for 2019-10-27 not changed, skipping.
2182Oct 27 20:18:52 localhost vdr: audio/alsa: using device 'default'
2183Oct 27 20:18:52 localhost vdr: audio/alsa: start delay 600ms
2184Oct 27 20:18:53 localhost epgd: Downloaded 'BR-S' for 2019-10-27 with (75262) Bytes, changed since last load.
2185Oct 27 20:18:53 localhost vdr: video: decoder buffer empty, duping frame (732/18) 4 v-buf
2186Oct 27 20:18:53 localhost vdr: video: slow down video, duping frame
2187Oct 27 20:18:53 localhost vdr: video: 23:34:53.563 +119 615 0/\ms 12+7+4 v-buf
2188Oct 27 20:18:54 localhost vdr: video/vdpau: synced after 47 frames
2189Oct 27 20:18:54 localhost epgd: Downloaded 'CC' for 2019-10-27 with (97221) Bytes, changed since last load.
2190Oct 27 20:18:55 localhost epgd: Downloaded 'CNBC' for 2019-10-27 not changed, skipping.
2191Oct 27 20:18:55 localhost epgd: Downloaded 'DISNE' for 2019-10-27 with (71822) Bytes, changed since last load.
2192Oct 27 20:18:56 localhost epgd: Downloaded 'DMAX' for 2019-10-27 with (31742) Bytes, changed since last load.
2193Oct 27 20:18:57 localhost vdr: [2421] animator thread thread ended (pid=1799, tid=2421)
2194Oct 27 20:18:57 localhost epgd: Downloaded 'EURON' for 2019-10-27 not changed, skipping.
2195Oct 27 20:18:58 localhost epgd: Downloaded 'FES' for 2019-10-27 with (85942) Bytes, changed since last load.
2196Oct 27 20:18:59 localhost epgd: Downloaded 'HR' for 2019-10-27 with (66475) Bytes, changed since last load.
2197Oct 27 20:18:59 localhost epgd: Downloaded 'K1' for 2019-10-27 not changed, skipping.
2198Oct 27 20:19:00 localhost epgd: Downloaded 'K1DOKU' for 2019-10-27 not changed, skipping.
2199Oct 27 20:19:00 localhost epgd: Downloaded 'KIKA' for 2019-10-27 not changed, skipping.
2200Oct 27 20:19:00 localhost epgd: Downloaded 'MDR' for 2019-10-27 not changed, skipping.
2201Oct 27 20:19:01 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-27]
2202Oct 27 20:19:01 localhost epgd: Downloaded 'N24' for 2019-10-27 failed, code: 0.
2203Oct 27 20:19:01 localhost epgd: Downloaded 'N24DOKU' for 2019-10-27 not changed, skipping.
2204Oct 27 20:19:01 localhost epgd: Downloaded 'NDR-HH' for 2019-10-27 not changed, skipping.
2205Oct 27 20:19:01 localhost epgd: Downloaded 'NICK' for 2019-10-27 with (54122) Bytes, changed since last load.
2206Oct 27 20:19:02 localhost epgd: Downloaded 'NTV' for 2019-10-27 not changed, skipping.
2207Oct 27 20:19:02 localhost epgd: Downloaded 'OE24TV' for 2019-10-27 not changed, skipping.
2208Oct 27 20:19:02 localhost epgd: Downloaded 'ORF1' for 2019-10-27 with (63821) Bytes, changed since last load.
2209Oct 27 20:19:03 localhost epgd: Downloaded 'ORF2' for 2019-10-27 with (58323) Bytes, changed since last load.
2210Oct 27 20:19:05 localhost epgd: Downloaded 'ORF3' for 2019-10-27 not changed, skipping.
2211Oct 27 20:19:05 localhost epgd: Downloaded 'ORFSP' for 2019-10-27 not changed, skipping.
2212Oct 27 20:19:05 localhost epgd: Downloaded 'PHOEN' for 2019-10-27 not changed, skipping.
2213Oct 27 20:19:05 localhost epgd: Downloaded 'PRO7' for 2019-10-27 with (39032) Bytes, changed since last load.
2214Oct 27 20:19:06 localhost epgd: Downloaded 'PRO7M' for 2019-10-27 not changed, skipping.
2215Oct 27 20:19:07 localhost epgd: Downloaded 'PULS4' for 2019-10-27 with (47323) Bytes, changed since last load.
2216Oct 27 20:19:07 localhost epgd: Downloaded 'RB-TV' for 2019-10-27 not changed, skipping.
2217Oct 27 20:19:08 localhost systemd[1]: Starting Stop ureadahead data collection...
2218Oct 27 20:19:08 localhost systemd[1]: Started Stop ureadahead data collection.
2219Oct 27 20:19:08 localhost epgd: Downloaded 'RBB' for 2019-10-27 not changed, skipping.
2220Oct 27 20:19:09 localhost epgd: Downloaded 'RIC' for 2019-10-27 not changed, skipping.
2221Oct 27 20:19:10 localhost epgd: Downloaded 'RTL' for 2019-10-27 not changed, skipping.
2222Oct 27 20:19:10 localhost epgd: Downloaded 'RTL-N' for 2019-10-27 with (49245) Bytes, changed since last load.
2223Oct 27 20:19:11 localhost epgd: Downloaded 'RTL2' for 2019-10-27 with (43515) Bytes, changed since last load.
2224Oct 27 20:19:12 localhost epgd: Downloaded 'SAT1' for 2019-10-27 not changed, skipping.
2225Oct 27 20:19:12 localhost epgd: Downloaded 'SAT1G' for 2019-10-27 with (66298) Bytes, changed since last load.
2226Oct 27 20:19:13 localhost epgd: Downloaded 'SERVU' for 2019-10-27 not changed, skipping.
2227Oct 27 20:19:14 localhost vdr: epg2vdr: Trying to re-connect to database!
2228Oct 27 20:19:14 localhost vdr: epg2vdr: Info: Last update was at '26.10.19 21:33:14'
2229Oct 27 20:19:14 localhost vdr: epg2vdr: Handler: Start reading external ids from db
2230Oct 27 20:19:14 localhost vdr: epg2vdr: Handler: Finished reading external id's from db, got 180 id's
2231Oct 27 20:19:14 localhost vdr: epg2vdr: Connection established successfull!
2232Oct 27 20:19:14 localhost vdr: epg2vdr: Cleanup deleted recordings at database (forced)
2233Oct 27 20:19:14 localhost vdr: epg2vdr: Info: Marked 0 recordings as deleted
2234Oct 27 20:19:14 localhost vdr: epg2vdr: Updating recording list table
2235Oct 27 20:19:14 localhost epgd: Downloaded 'SIXX' for 2019-10-27 with (42294) Bytes, changed since last load.
2236Oct 27 20:19:15 localhost vdr: epg2vdr: Info: Found 256 recordings; 0 inserted; 77 updated and 53 directories
2237Oct 27 20:19:15 localhost vdr: epg2vdr: Detected epgd state 'busy (events)' (3)
2238Oct 27 20:19:15 localhost epgd: Downloaded 'SR' for 2019-10-27 with (88283) Bytes, changed since last load.
2239Oct 27 20:19:16 localhost epgd: Downloaded 'SUPER' for 2019-10-27 with (35687) Bytes, changed since last load.
2240Oct 27 20:19:16 localhost epgd: Downloaded 'SWRBW' for 2019-10-27 with (87853) Bytes, changed since last load.
2241Oct 27 20:19:18 localhost epgd: Downloaded 'TAG24' for 2019-10-27 not changed, skipping.
2242Oct 27 20:19:19 localhost epgd: Downloaded 'TELE5' for 2019-10-27 with (47433) Bytes, changed since last load.
2243Oct 27 20:19:20 localhost epgd: Downloaded 'TLC' for 2019-10-27 not changed, skipping.
2244Oct 27 20:19:21 localhost epgd: Downloaded 'TOGGO' for 2019-10-27 not changed, skipping.
2245Oct 27 20:19:21 localhost epgd: Downloaded 'VOX' for 2019-10-27 with (60528) Bytes, changed since last load.
2246Oct 27 20:19:23 localhost epgd: Downloaded 'WDR' for 2019-10-27 with (64038) Bytes, changed since last load.
2247Oct 27 20:19:24 localhost vdr: video: slow down video, duping frame
2248Oct 27 20:19:24 localhost vdr: video: speed up video, droping frame
2249Oct 27 20:19:24 localhost vdr: video: 23:35:23.963 -25 630 0/\ms 14+5+4 v-buf
2250Oct 27 20:19:25 localhost epgd: Downloaded 'WDWTV' for 2019-10-27 not changed, skipping.
2251Oct 27 20:19:25 localhost epgd: Downloaded 'ZDF' for 2019-10-27 with (116261) Bytes, changed since last load.
2252Oct 27 20:19:26 localhost epgd: Downloaded 'ZINFO' for 2019-10-27 not changed, skipping.
2253Oct 27 20:19:26 localhost epgd: Downloading images...
2254Oct 27 20:19:27 localhost epgd: Downloaded 1 images
2255Oct 27 20:19:27 localhost epgd: Updating 'tvm' day today+1 now
2256Oct 27 20:19:27 localhost epgd: Skipping day 1 for TVM plugin, since all days ar performed on day 0
2257Oct 27 20:19:27 localhost epgd: Updating 'tvsp' day today+1 now
2258Oct 27 20:19:27 localhost epgd: Downloaded '2NEO' for 2019-10-28 with (90983) Bytes, changed since last load.
2259Oct 27 20:19:27 localhost epgd: Downloaded '3SAT' for 2019-10-28 with (83614) Bytes, changed since last load.
2260Oct 27 20:19:28 localhost epgd: Downloaded 'ALPHA' for 2019-10-28 not changed, skipping.
2261Oct 27 20:19:28 localhost epgd: Downloaded 'ANIXE' for 2019-10-28 not changed, skipping.
2262Oct 27 20:19:28 localhost epgd: Downloaded 'ARD' for 2019-10-28 with (72632) Bytes, changed since last load.
2263Oct 27 20:19:29 localhost epgd: Downloaded 'ARTE' for 2019-10-28 with (81562) Bytes, changed since last load.
2264Oct 27 20:19:30 localhost epgd: Downloaded 'ATV' for 2019-10-28 with (48412) Bytes, changed since last load.
2265Oct 27 20:19:31 localhost epgd: Downloaded 'ATV2' for 2019-10-28 not changed, skipping.
2266Oct 27 20:19:31 localhost epgd: Downloaded 'BBC' for 2019-10-28 not changed, skipping.
2267Oct 27 20:19:31 localhost epgd: Downloaded 'BR-S' for 2019-10-28 with (79825) Bytes, changed since last load.
2268Oct 27 20:19:32 localhost epgd: Downloaded 'CC' for 2019-10-28 with (101887) Bytes, changed since last load.
2269Oct 27 20:19:32 localhost epgd: Downloaded 'CNBC' for 2019-10-28 not changed, skipping.
2270Oct 27 20:19:33 localhost epgd: Downloaded 'DISNE' for 2019-10-28 with (74069) Bytes, changed since last load.
2271Oct 27 20:19:33 localhost epgd: Downloaded 'DMAX' for 2019-10-28 with (34919) Bytes, changed since last load.
2272Oct 27 20:19:34 localhost epgd: Downloaded 'EURON' for 2019-10-28 not changed, skipping.
2273Oct 27 20:19:34 localhost epgd: Downloaded 'FES' for 2019-10-28 with (91635) Bytes, changed since last load.
2274Oct 27 20:19:34 localhost epgd: Downloaded 'HR' for 2019-10-28 with (70866) Bytes, changed since last load.
2275Oct 27 20:19:35 localhost epgd: Downloaded 'K1' for 2019-10-28 with (56201) Bytes, changed since last load.
2276Oct 27 20:19:35 localhost epgd: Downloaded 'K1DOKU' for 2019-10-28 not changed, skipping.
2277Oct 27 20:19:36 localhost epgd: Downloaded 'KIKA' for 2019-10-28 not changed, skipping.
2278Oct 27 20:19:36 localhost epgd: Downloaded 'MDR' for 2019-10-28 with (69039) Bytes, changed since last load.
2279Oct 27 20:19:37 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-28]
2280Oct 27 20:19:37 localhost epgd: Downloaded 'N24' for 2019-10-28 failed, code: 0.
2281Oct 27 20:19:37 localhost epgd: Downloaded 'N24DOKU' for 2019-10-28 not changed, skipping.
2282Oct 27 20:19:37 localhost epgd: Downloaded 'NDR-HH' for 2019-10-28 with (82337) Bytes, changed since last load.
2283Oct 27 20:19:38 localhost epgd: Downloaded 'NICK' for 2019-10-28 with (65384) Bytes, changed since last load.
2284Oct 27 20:19:39 localhost epgd: Downloaded 'NTV' for 2019-10-28 not changed, skipping.
2285Oct 27 20:19:39 localhost epgd: Downloaded 'OE24TV' for 2019-10-28 not changed, skipping.
2286Oct 27 20:19:40 localhost epgd: Downloaded 'ORF1' for 2019-10-28 with (107161) Bytes, changed since last load.
2287Oct 27 20:19:40 localhost epgd: Downloaded 'ORF2' for 2019-10-28 with (54679) Bytes, changed since last load.
2288Oct 27 20:19:42 localhost epgd: Downloaded 'ORF3' for 2019-10-28 not changed, skipping.
2289Oct 27 20:19:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
2290Oct 27 20:19:42 localhost epgd: Downloaded 'ORFSP' for 2019-10-28 not changed, skipping.
2291Oct 27 20:19:42 localhost epgd: Downloaded 'PHOEN' for 2019-10-28 not changed, skipping.
2292Oct 27 20:19:43 localhost epgd: Downloaded 'PRO7' for 2019-10-28 with (106261) Bytes, changed since last load.
2293Oct 27 20:19:44 localhost epgd: Downloaded 'PRO7M' for 2019-10-28 with (58358) Bytes, changed since last load.
2294Oct 27 20:19:44 localhost epgd: Downloaded 'PULS4' for 2019-10-28 not changed, skipping.
2295Oct 27 20:19:44 localhost epgd: Downloaded 'RB-TV' for 2019-10-28 with (85215) Bytes, changed since last load.
2296Oct 27 20:19:45 localhost epgd: Downloaded 'RBB' for 2019-10-28 with (73069) Bytes, changed since last load.
2297Oct 27 20:19:45 localhost epgd: Downloaded 'RIC' for 2019-10-28 not changed, skipping.
2298Oct 27 20:19:45 localhost epgd: Downloaded 'RTL' for 2019-10-28 not changed, skipping.
2299Oct 27 20:19:46 localhost epgd: Downloaded 'RTL-N' for 2019-10-28 with (48271) Bytes, changed since last load.
2300Oct 27 20:19:46 localhost epgd: Downloaded 'RTL2' for 2019-10-28 not changed, skipping.
2301Oct 27 20:19:46 localhost epgd: Downloaded 'SAT1' for 2019-10-28 not changed, skipping.
2302Oct 27 20:19:46 localhost epgd: Downloaded 'SAT1G' for 2019-10-28 with (54441) Bytes, changed since last load.
2303Oct 27 20:19:47 localhost epgd: Downloaded 'SERVU' for 2019-10-28 not changed, skipping.
2304Oct 27 20:19:47 localhost epgd: Downloaded 'SIXX' for 2019-10-28 with (60156) Bytes, changed since last load.
2305Oct 27 20:19:47 localhost epgd: Downloaded 'SR' for 2019-10-28 not changed, skipping.
2306Oct 27 20:19:47 localhost epgd: Downloaded 'SUPER' for 2019-10-28 not changed, skipping.
2307Oct 27 20:19:48 localhost epgd: Downloaded 'SWRBW' for 2019-10-28 not changed, skipping.
2308Oct 27 20:19:48 localhost epgd: Downloaded 'TAG24' for 2019-10-28 not changed, skipping.
2309Oct 27 20:19:48 localhost epgd: Downloaded 'TELE5' for 2019-10-28 with (56873) Bytes, changed since last load.
2310Oct 27 20:19:48 localhost epgd: Downloaded 'TLC' for 2019-10-28 not changed, skipping.
2311Oct 27 20:19:49 localhost epgd: Downloaded 'TOGGO' for 2019-10-28 not changed, skipping.
2312Oct 27 20:19:49 localhost epgd: Downloaded 'VOX' for 2019-10-28 with (52555) Bytes, changed since last load.
2313Oct 27 20:19:49 localhost epgd: Downloaded 'WDR' for 2019-10-28 with (74911) Bytes, changed since last load.
2314Oct 27 20:19:51 localhost epgd: Downloaded 'WDWTV' for 2019-10-28 not changed, skipping.
2315Oct 27 20:19:51 localhost epgd: Downloaded 'ZDF' for 2019-10-28 with (68953) Bytes, changed since last load.
2316Oct 27 20:19:52 localhost epgd: Downloaded 'ZINFO' for 2019-10-28 not changed, skipping.
2317Oct 27 20:19:52 localhost epgd: Downloading images...
2318Oct 27 20:19:53 localhost vdr: video: 23:35:52.723 +12 580 0/\ms 12+6+4 v-buf
2319Oct 27 20:19:53 localhost epgd: Downloaded 2 images
2320Oct 27 20:19:53 localhost epgd: Updating 'tvm' day today+2 now
2321Oct 27 20:19:53 localhost epgd: Skipping day 2 for TVM plugin, since all days ar performed on day 0
2322Oct 27 20:19:53 localhost epgd: Updating 'tvsp' day today+2 now
2323Oct 27 20:19:54 localhost epgd: Downloaded '2NEO' for 2019-10-29 with (106390) Bytes, changed since last load.
2324Oct 27 20:19:54 localhost epgd: Downloaded '3SAT' for 2019-10-29 not changed, skipping.
2325Oct 27 20:19:55 localhost epgd: Downloaded 'ALPHA' for 2019-10-29 not changed, skipping.
2326Oct 27 20:19:55 localhost vdr: epg2vdr: Handler: Init handler instance for thread 1932
2327Oct 27 20:19:55 localhost epgd: Downloaded 'ANIXE' for 2019-10-29 with (45551) Bytes, changed since last load.
2328Oct 27 20:19:55 localhost epgd: Downloaded 'ARD' for 2019-10-29 with (75749) Bytes, changed since last load.
2329Oct 27 20:19:56 localhost epgd: Downloaded 'ARTE' for 2019-10-29 with (87574) Bytes, changed since last load.
2330Oct 27 20:19:57 localhost epgd: Downloaded 'ATV' for 2019-10-29 not changed, skipping.
2331Oct 27 20:19:57 localhost epgd: Downloaded 'ATV2' for 2019-10-29 with (42612) Bytes, changed since last load.
2332Oct 27 20:19:57 localhost epgd: Downloaded 'BBC' for 2019-10-29 not changed, skipping.
2333Oct 27 20:19:58 localhost epgd: Downloaded 'BR-S' for 2019-10-29 with (73589) Bytes, changed since last load.
2334Oct 27 20:19:58 localhost epgd: Downloaded 'CC' for 2019-10-29 with (102867) Bytes, changed since last load.
2335Oct 27 20:19:58 localhost epgd: Downloaded 'CNBC' for 2019-10-29 not changed, skipping.
2336Oct 27 20:19:59 localhost epgd: Downloaded 'DISNE' for 2019-10-29 with (79460) Bytes, changed since last load.
2337Oct 27 20:19:59 localhost epgd: Downloaded 'DMAX' for 2019-10-29 with (38741) Bytes, changed since last load.
2338Oct 27 20:20:00 localhost epgd: Downloaded 'EURON' for 2019-10-29 not changed, skipping.
2339Oct 27 20:20:00 localhost epgd: Downloaded 'FES' for 2019-10-29 with (96502) Bytes, changed since last load.
2340Oct 27 20:20:01 localhost epgd: Downloaded 'HR' for 2019-10-29 with (80006) Bytes, changed since last load.
2341Oct 27 20:20:02 localhost epgd: Downloaded 'K1' for 2019-10-29 with (58200) Bytes, changed since last load.
2342Oct 27 20:20:02 localhost epgd: Downloaded 'K1DOKU' for 2019-10-29 not changed, skipping.
2343Oct 27 20:20:02 localhost epgd: Downloaded 'KIKA' for 2019-10-29 not changed, skipping.
2344Oct 27 20:20:03 localhost epgd: Downloaded 'MDR' for 2019-10-29 with (75760) Bytes, changed since last load.
2345Oct 27 20:20:03 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-29]
2346Oct 27 20:20:03 localhost epgd: Downloaded 'N24' for 2019-10-29 failed, code: 0.
2347Oct 27 20:20:04 localhost epgd: Downloaded 'N24DOKU' for 2019-10-29 not changed, skipping.
2348Oct 27 20:20:05 localhost epgd: Downloaded 'NDR-HH' for 2019-10-29 with (73911) Bytes, changed since last load.
2349Oct 27 20:20:06 localhost epgd: Downloaded 'NICK' for 2019-10-29 with (63412) Bytes, changed since last load.
2350Oct 27 20:20:06 localhost epgd: Downloaded 'NTV' for 2019-10-29 not changed, skipping.
2351Oct 27 20:20:06 localhost epgd: Downloaded 'OE24TV' for 2019-10-29 not changed, skipping.
2352Oct 27 20:20:07 localhost epgd: Downloaded 'ORF1' for 2019-10-29 with (111616) Bytes, changed since last load.
2353Oct 27 20:20:07 localhost epgd: Downloaded 'ORF2' for 2019-10-29 with (54723) Bytes, changed since last load.
2354Oct 27 20:20:09 localhost epgd: Downloaded 'ORF3' for 2019-10-29 not changed, skipping.
2355Oct 27 20:20:09 localhost epgd: Downloaded 'ORFSP' for 2019-10-29 not changed, skipping.
2356Oct 27 20:20:09 localhost epgd: Downloaded 'PHOEN' for 2019-10-29 not changed, skipping.
2357Oct 27 20:20:09 localhost epgd: Downloaded 'PRO7' for 2019-10-29 with (101107) Bytes, changed since last load.
2358Oct 27 20:20:10 localhost epgd: Downloaded 'PRO7M' for 2019-10-29 with (49920) Bytes, changed since last load.
2359Oct 27 20:20:10 localhost epgd: Downloaded 'PULS4' for 2019-10-29 not changed, skipping.
2360Oct 27 20:20:10 localhost epgd: Downloaded 'RB-TV' for 2019-10-29 with (76715) Bytes, changed since last load.
2361Oct 27 20:20:11 localhost epgd: Downloaded 'RBB' for 2019-10-29 with (70361) Bytes, changed since last load.
2362Oct 27 20:20:12 localhost epgd: Downloaded 'RIC' for 2019-10-29 not changed, skipping.
2363Oct 27 20:20:12 localhost epgd: Downloaded 'RTL' for 2019-10-29 with (37621) Bytes, changed since last load.
2364Oct 27 20:20:13 localhost epgd: Downloaded 'RTL-N' for 2019-10-29 with (59265) Bytes, changed since last load.
2365Oct 27 20:20:13 localhost epgd: Downloaded 'RTL2' for 2019-10-29 not changed, skipping.
2366Oct 27 20:20:14 localhost epgd: Downloaded 'SAT1' for 2019-10-29 not changed, skipping.
2367Oct 27 20:20:14 localhost epgd: Downloaded 'SAT1G' for 2019-10-29 with (63983) Bytes, changed since last load.
2368Oct 27 20:20:15 localhost epgd: Downloaded 'SERVU' for 2019-10-29 with (61798) Bytes, changed since last load.
2369Oct 27 20:20:15 localhost vdr: epg2vdr: Update info.epg2vdr recordings
2370Oct 27 20:20:15 localhost vdr: epg2vdr: Updated 0 info.epg2vdr files
2371Oct 27 20:20:15 localhost epgd: Downloaded 'SIXX' for 2019-10-29 with (65838) Bytes, changed since last load.
2372Oct 27 20:20:15 localhost epgd: Downloaded 'SR' for 2019-10-29 not changed, skipping.
2373Oct 27 20:20:15 localhost epgd: Downloaded 'SUPER' for 2019-10-29 not changed, skipping.
2374Oct 27 20:20:15 localhost epgd: Downloaded 'SWRBW' for 2019-10-29 not changed, skipping.
2375Oct 27 20:20:16 localhost epgd: Downloaded 'TAG24' for 2019-10-29 not changed, skipping.
2376Oct 27 20:20:16 localhost epgd: Downloaded 'TELE5' for 2019-10-29 with (57365) Bytes, changed since last load.
2377Oct 27 20:20:16 localhost epgd: Downloaded 'TLC' for 2019-10-29 not changed, skipping.
2378Oct 27 20:20:16 localhost epgd: Downloaded 'TOGGO' for 2019-10-29 not changed, skipping.
2379Oct 27 20:20:17 localhost epgd: Downloaded 'VOX' for 2019-10-29 with (51367) Bytes, changed since last load.
2380Oct 27 20:20:17 localhost epgd: Downloaded 'WDR' for 2019-10-29 not changed, skipping.
2381Oct 27 20:20:18 localhost epgd: Downloaded 'WDWTV' for 2019-10-29 not changed, skipping.
2382Oct 27 20:20:18 localhost epgd: Downloaded 'ZDF' for 2019-10-29 with (72695) Bytes, changed since last load.
2383Oct 27 20:20:19 localhost epgd: Downloaded 'ZINFO' for 2019-10-29 not changed, skipping.
2384Oct 27 20:20:19 localhost epgd: Downloading images...
2385Oct 27 20:20:19 localhost epgd: Downloaded 1 images
2386Oct 27 20:20:19 localhost epgd: Updating 'tvm' day today+3 now
2387Oct 27 20:20:19 localhost epgd: Skipping day 3 for TVM plugin, since all days ar performed on day 0
2388Oct 27 20:20:19 localhost epgd: Updating 'tvsp' day today+3 now
2389Oct 27 20:20:20 localhost epgd: Downloaded '2NEO' for 2019-10-30 with (114138) Bytes, changed since last load.
2390Oct 27 20:20:20 localhost epgd: Downloaded '3SAT' for 2019-10-30 with (90297) Bytes, changed since last load.
2391Oct 27 20:20:21 localhost epgd: Downloaded 'ALPHA' for 2019-10-30 not changed, skipping.
2392Oct 27 20:20:21 localhost epgd: Downloaded 'ANIXE' for 2019-10-30 with (47735) Bytes, changed since last load.
2393Oct 27 20:20:22 localhost epgd: Downloaded 'ARD' for 2019-10-30 with (70686) Bytes, changed since last load.
2394Oct 27 20:20:22 localhost epgd: Downloaded 'ARTE' for 2019-10-30 with (82344) Bytes, changed since last load.
2395Oct 27 20:20:23 localhost epgd: Downloaded 'ATV' for 2019-10-30 not changed, skipping.
2396Oct 27 20:20:23 localhost epgd: Downloaded 'ATV2' for 2019-10-30 not changed, skipping.
2397Oct 27 20:20:24 localhost epgd: Downloaded 'BBC' for 2019-10-30 not changed, skipping.
2398Oct 27 20:20:25 localhost epgd: Downloaded 'BR-S' for 2019-10-30 with (83658) Bytes, changed since last load.
2399Oct 27 20:20:25 localhost epgd: Downloaded 'CC' for 2019-10-30 with (100718) Bytes, changed since last load.
2400Oct 27 20:20:26 localhost epgd: Downloaded 'CNBC' for 2019-10-30 not changed, skipping.
2401Oct 27 20:20:26 localhost epgd: Downloaded 'DISNE' for 2019-10-30 with (79841) Bytes, changed since last load.
2402Oct 27 20:20:27 localhost epgd: Downloaded 'DMAX' for 2019-10-30 with (35691) Bytes, changed since last load.
2403Oct 27 20:20:27 localhost epgd: Downloaded 'EURON' for 2019-10-30 not changed, skipping.
2404Oct 27 20:20:28 localhost epgd: Downloaded 'FES' for 2019-10-30 with (89955) Bytes, changed since last load.
2405Oct 27 20:20:28 localhost epgd: Downloaded 'HR' for 2019-10-30 with (81383) Bytes, changed since last load.
2406Oct 27 20:20:28 localhost epgd: Downloaded 'K1' for 2019-10-30 with (63298) Bytes, changed since last load.
2407Oct 27 20:20:29 localhost epgd: Downloaded 'K1DOKU' for 2019-10-30 not changed, skipping.
2408Oct 27 20:20:29 localhost epgd: Downloaded 'KIKA' for 2019-10-30 not changed, skipping.
2409Oct 27 20:20:30 localhost epgd: Downloaded 'MDR' for 2019-10-30 with (77792) Bytes, changed since last load.
2410Oct 27 20:20:30 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-30]
2411Oct 27 20:20:30 localhost epgd: Downloaded 'N24' for 2019-10-30 failed, code: 0.
2412Oct 27 20:20:31 localhost epgd: Downloaded 'N24DOKU' for 2019-10-30 not changed, skipping.
2413Oct 27 20:20:32 localhost epgd: Downloaded 'NDR-HH' for 2019-10-30 with (79852) Bytes, changed since last load.
2414Oct 27 20:20:33 localhost epgd: Downloaded 'NICK' for 2019-10-30 with (64460) Bytes, changed since last load.
2415Oct 27 20:20:34 localhost epgd: Downloaded 'NTV' for 2019-10-30 not changed, skipping.
2416Oct 27 20:20:34 localhost epgd: Downloaded 'OE24TV' for 2019-10-30 not changed, skipping.
2417Oct 27 20:20:34 localhost epgd: Downloaded 'ORF1' for 2019-10-30 with (94215) Bytes, changed since last load.
2418Oct 27 20:20:35 localhost epgd: Downloaded 'ORF2' for 2019-10-30 with (60923) Bytes, changed since last load.
2419Oct 27 20:20:36 localhost epgd: Downloaded 'ORF3' for 2019-10-30 not changed, skipping.
2420Oct 27 20:20:37 localhost epgd: Downloaded 'ORFSP' for 2019-10-30 not changed, skipping.
2421Oct 27 20:20:37 localhost epgd: Downloaded 'PHOEN' for 2019-10-30 not changed, skipping.
2422Oct 27 20:20:38 localhost epgd: Downloaded 'PRO7' for 2019-10-30 with (104497) Bytes, changed since last load.
2423Oct 27 20:20:39 localhost epgd: Downloaded 'PRO7M' for 2019-10-30 with (57705) Bytes, changed since last load.
2424Oct 27 20:20:40 localhost epgd: Downloaded 'PULS4' for 2019-10-30 not changed, skipping.
2425Oct 27 20:20:41 localhost epgd: Downloaded 'RB-TV' for 2019-10-30 with (82663) Bytes, changed since last load.
2426Oct 27 20:20:42 localhost epgd: Downloaded 'RBB' for 2019-10-30 with (68129) Bytes, changed since last load.
2427Oct 27 20:20:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
2428Oct 27 20:20:42 localhost epgd: Downloaded 'RIC' for 2019-10-30 not changed, skipping.
2429Oct 27 20:20:43 localhost epgd: Downloaded 'RTL' for 2019-10-30 with (39289) Bytes, changed since last load.
2430Oct 27 20:20:44 localhost epgd: Downloaded 'RTL-N' for 2019-10-30 with (60593) Bytes, changed since last load.
2431Oct 27 20:20:45 localhost epgd: Downloaded 'RTL2' for 2019-10-30 not changed, skipping.
2432Oct 27 20:20:45 localhost epgd: Downloaded 'SAT1' for 2019-10-30 not changed, skipping.
2433Oct 27 20:20:46 localhost epgd: Downloaded 'SAT1G' for 2019-10-30 with (76505) Bytes, changed since last load.
2434Oct 27 20:20:47 localhost epgd: Downloaded 'SERVU' for 2019-10-30 not changed, skipping.
2435Oct 27 20:20:47 localhost epgd: Downloaded 'SIXX' for 2019-10-30 with (50599) Bytes, changed since last load.
2436Oct 27 20:20:48 localhost epgd: Downloaded 'SR' for 2019-10-30 not changed, skipping.
2437Oct 27 20:20:48 localhost epgd: Downloaded 'SUPER' for 2019-10-30 not changed, skipping.
2438Oct 27 20:20:48 localhost epgd: Downloaded 'SWRBW' for 2019-10-30 not changed, skipping.
2439Oct 27 20:20:48 localhost epgd: Downloaded 'TAG24' for 2019-10-30 not changed, skipping.
2440Oct 27 20:20:49 localhost epgd: Downloaded 'TELE5' for 2019-10-30 with (51152) Bytes, changed since last load.
2441Oct 27 20:20:50 localhost epgd: Downloaded 'TLC' for 2019-10-30 not changed, skipping.
2442Oct 27 20:20:51 localhost epgd: Downloaded 'TOGGO' for 2019-10-30 not changed, skipping.
2443Oct 27 20:20:52 localhost epgd: Downloaded 'VOX' for 2019-10-30 with (59738) Bytes, changed since last load.
2444Oct 27 20:20:53 localhost vdr: video: 23:36:52.723 +13 581 0/\ms 11+6+4 v-buf
2445Oct 27 20:20:53 localhost epgd: Downloaded 'WDR' for 2019-10-30 not changed, skipping.
2446Oct 27 20:20:54 localhost epgd: Downloaded 'WDWTV' for 2019-10-30 not changed, skipping.
2447Oct 27 20:20:56 localhost epgd: Downloaded 'ZDF' for 2019-10-30 with (85625) Bytes, changed since last load.
2448Oct 27 20:20:57 localhost epgd: Downloaded 'ZINFO' for 2019-10-30 not changed, skipping.
2449Oct 27 20:20:57 localhost epgd: Downloading images...
2450Oct 27 20:20:57 localhost epgd: Downloaded 0 images
2451Oct 27 20:20:57 localhost epgd: Updating 'tvm' day today+4 now
2452Oct 27 20:20:57 localhost epgd: Skipping day 4 for TVM plugin, since all days ar performed on day 0
2453Oct 27 20:20:57 localhost epgd: Updating 'tvsp' day today+4 now
2454Oct 27 20:20:57 localhost epgd: Downloaded '2NEO' for 2019-10-31 with (111990) Bytes, changed since last load.
2455Oct 27 20:20:58 localhost epgd: Downloaded '3SAT' for 2019-10-31 not changed, skipping.
2456Oct 27 20:20:58 localhost epgd: Downloaded 'ALPHA' for 2019-10-31 not changed, skipping.
2457Oct 27 20:20:58 localhost epgd: Downloaded 'ANIXE' for 2019-10-31 not changed, skipping.
2458Oct 27 20:20:59 localhost epgd: Downloaded 'ARD' for 2019-10-31 with (69409) Bytes, changed since last load.
2459Oct 27 20:21:00 localhost epgd: Downloaded 'ARTE' for 2019-10-31 with (94117) Bytes, changed since last load.
2460Oct 27 20:21:00 localhost epgd: Downloaded 'ATV' for 2019-10-31 not changed, skipping.
2461Oct 27 20:21:00 localhost epgd: Downloaded 'ATV2' for 2019-10-31 not changed, skipping.
2462Oct 27 20:21:00 localhost epgd: Downloaded 'BBC' for 2019-10-31 not changed, skipping.
2463Oct 27 20:21:00 localhost epgd: Downloaded 'BR-S' for 2019-10-31 with (78968) Bytes, changed since last load.
2464Oct 27 20:21:01 localhost epgd: Downloaded 'CC' for 2019-10-31 with (103145) Bytes, changed since last load.
2465Oct 27 20:21:01 localhost epgd: Downloaded 'CNBC' for 2019-10-31 not changed, skipping.
2466Oct 27 20:21:01 localhost epgd: Downloaded 'DISNE' for 2019-10-31 with (79541) Bytes, changed since last load.
2467Oct 27 20:21:01 localhost epgd: Downloaded 'DMAX' for 2019-10-31 with (33113) Bytes, changed since last load.
2468Oct 27 20:21:02 localhost epgd: Downloaded 'EURON' for 2019-10-31 not changed, skipping.
2469Oct 27 20:21:02 localhost epgd: Downloaded 'FES' for 2019-10-31 with (107639) Bytes, changed since last load.
2470Oct 27 20:21:02 localhost epgd: Downloaded 'HR' for 2019-10-31 with (76626) Bytes, changed since last load.
2471Oct 27 20:21:02 localhost epgd: Downloaded 'K1' for 2019-10-31 with (46051) Bytes, changed since last load.
2472Oct 27 20:21:03 localhost epgd: Downloaded 'K1DOKU' for 2019-10-31 not changed, skipping.
2473Oct 27 20:21:03 localhost epgd: Downloaded 'KIKA' for 2019-10-31 not changed, skipping.
2474Oct 27 20:21:03 localhost epgd: Downloaded 'MDR' for 2019-10-31 with (76255) Bytes, changed since last load.
2475Oct 27 20:21:04 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-31]
2476Oct 27 20:21:04 localhost epgd: Downloaded 'N24' for 2019-10-31 failed, code: 0.
2477Oct 27 20:21:04 localhost epgd: Downloaded 'N24DOKU' for 2019-10-31 not changed, skipping.
2478Oct 27 20:21:05 localhost epgd: Downloaded 'NDR-HH' for 2019-10-31 with (81994) Bytes, changed since last load.
2479Oct 27 20:21:06 localhost epgd: Downloaded 'NICK' for 2019-10-31 with (59266) Bytes, changed since last load.
2480Oct 27 20:21:06 localhost epgd: Downloaded 'NTV' for 2019-10-31 not changed, skipping.
2481Oct 27 20:21:06 localhost epgd: Downloaded 'OE24TV' for 2019-10-31 not changed, skipping.
2482Oct 27 20:21:06 localhost epgd: Downloaded 'ORF1' for 2019-10-31 with (100383) Bytes, changed since last load.
2483Oct 27 20:21:06 localhost epgd: Downloaded 'ORF2' for 2019-10-31 with (55031) Bytes, changed since last load.
2484Oct 27 20:21:07 localhost epgd: Downloaded 'ORF3' for 2019-10-31 not changed, skipping.
2485Oct 27 20:21:08 localhost epgd: Downloaded 'ORFSP' for 2019-10-31 not changed, skipping.
2486Oct 27 20:21:08 localhost epgd: Downloaded 'PHOEN' for 2019-10-31 not changed, skipping.
2487Oct 27 20:21:08 localhost epgd: Downloaded 'PRO7' for 2019-10-31 with (85610) Bytes, changed since last load.
2488Oct 27 20:21:08 localhost epgd: Downloaded 'PRO7M' for 2019-10-31 with (47898) Bytes, changed since last load.
2489Oct 27 20:21:08 localhost epgd: Downloaded 'PULS4' for 2019-10-31 not changed, skipping.
2490Oct 27 20:21:08 localhost epgd: Downloaded 'RB-TV' for 2019-10-31 with (82666) Bytes, changed since last load.
2491Oct 27 20:21:09 localhost epgd: Downloaded 'RBB' for 2019-10-31 with (63772) Bytes, changed since last load.
2492Oct 27 20:21:10 localhost epgd: Downloaded 'RIC' for 2019-10-31 not changed, skipping.
2493Oct 27 20:21:10 localhost epgd: Downloaded 'RTL' for 2019-10-31 not changed, skipping.
2494Oct 27 20:21:11 localhost epgd: Downloaded 'RTL-N' for 2019-10-31 with (50506) Bytes, changed since last load.
2495Oct 27 20:21:12 localhost epgd: Downloaded 'RTL2' for 2019-10-31 with (36474) Bytes, changed since last load.
2496Oct 27 20:21:12 localhost epgd: Downloaded 'SAT1' for 2019-10-31 with (40544) Bytes, changed since last load.
2497Oct 27 20:21:13 localhost epgd: Downloaded 'SAT1G' for 2019-10-31 with (71563) Bytes, changed since last load.
2498Oct 27 20:21:13 localhost epgd: Downloaded 'SERVU' for 2019-10-31 with (53926) Bytes, changed since last load.
2499Oct 27 20:21:14 localhost epgd: Downloaded 'SIXX' for 2019-10-31 with (59157) Bytes, changed since last load.
2500Oct 27 20:21:15 localhost epgd: Downloaded 'SR' for 2019-10-31 not changed, skipping.
2501Oct 27 20:21:15 localhost epgd: Downloaded 'SUPER' for 2019-10-31 with (43250) Bytes, changed since last load.
2502Oct 27 20:21:15 localhost epgd: Downloaded 'SWRBW' for 2019-10-31 not changed, skipping.
2503Oct 27 20:21:15 localhost epgd: Downloaded 'TAG24' for 2019-10-31 not changed, skipping.
2504Oct 27 20:21:15 localhost epgd: Downloaded 'TELE5' for 2019-10-31 with (55216) Bytes, changed since last load.
2505Oct 27 20:21:16 localhost epgd: Downloaded 'TLC' for 2019-10-31 not changed, skipping.
2506Oct 27 20:21:16 localhost epgd: Downloaded 'TOGGO' for 2019-10-31 not changed, skipping.
2507Oct 27 20:21:16 localhost epgd: Downloaded 'VOX' for 2019-10-31 with (55246) Bytes, changed since last load.
2508Oct 27 20:21:16 localhost epgd: Downloaded 'WDR' for 2019-10-31 with (61211) Bytes, changed since last load.
2509Oct 27 20:21:17 localhost epgd: Downloaded 'WDWTV' for 2019-10-31 not changed, skipping.
2510Oct 27 20:21:17 localhost epgd: Downloaded 'ZDF' for 2019-10-31 with (92024) Bytes, changed since last load.
2511Oct 27 20:21:18 localhost epgd: Downloaded 'ZINFO' for 2019-10-31 with (110554) Bytes, changed since last load.
2512Oct 27 20:21:18 localhost epgd: Downloading images...
2513Oct 27 20:21:18 localhost epgd: Downloaded 1 images
2514Oct 27 20:21:18 localhost epgd: Updating 'tvm' day today+5 now
2515Oct 27 20:21:18 localhost epgd: Skipping day 5 for TVM plugin, since all days ar performed on day 0
2516Oct 27 20:21:18 localhost epgd: Updating 'tvsp' day today+5 now
2517Oct 27 20:21:18 localhost epgd: Downloaded '2NEO' for 2019-11-01 with (111217) Bytes, changed since last load.
2518Oct 27 20:21:19 localhost epgd: Downloaded '3SAT' for 2019-11-01 not changed, skipping.
2519Oct 27 20:21:19 localhost epgd: Downloaded 'ALPHA' for 2019-11-01 with (65159) Bytes, changed since last load.
2520Oct 27 20:21:19 localhost epgd: Downloaded 'ANIXE' for 2019-11-01 with (43146) Bytes, changed since last load.
2521Oct 27 20:21:19 localhost epgd: Downloaded 'ARD' for 2019-11-01 with (66946) Bytes, changed since last load.
2522Oct 27 20:21:20 localhost epgd: Downloaded 'ARTE' for 2019-11-01 with (71487) Bytes, changed since last load.
2523Oct 27 20:21:20 localhost epgd: Downloaded 'ATV' for 2019-11-01 with (48749) Bytes, changed since last load.
2524Oct 27 20:21:20 localhost epgd: Downloaded 'ATV2' for 2019-11-01 with (43623) Bytes, changed since last load.
2525Oct 27 20:21:23 localhost epgd: Downloaded 'BBC' for 2019-11-01 not changed, skipping.
2526Oct 27 20:21:23 localhost epgd: Downloaded 'BR-S' for 2019-11-01 not changed, skipping.
2527Oct 27 20:21:24 localhost epgd: Downloaded 'CC' for 2019-11-01 with (102408) Bytes, changed since last load.
2528Oct 27 20:21:25 localhost epgd: Downloaded 'CNBC' for 2019-11-01 not changed, skipping.
2529Oct 27 20:21:26 localhost epgd: Downloaded 'DISNE' for 2019-11-01 with (73592) Bytes, changed since last load.
2530Oct 27 20:21:28 localhost epgd: Downloaded 'DMAX' for 2019-11-01 with (33237) Bytes, changed since last load.
2531Oct 27 20:21:29 localhost epgd: Downloaded 'EURON' for 2019-11-01 not changed, skipping.
2532Oct 27 20:21:29 localhost epgd: Downloaded 'FES' for 2019-11-01 with (89067) Bytes, changed since last load.
2533Oct 27 20:21:32 localhost epgd: Downloaded 'HR' for 2019-11-01 with (71032) Bytes, changed since last load.
2534Oct 27 20:21:34 localhost epgd: Downloaded 'K1' for 2019-11-01 with (48061) Bytes, changed since last load.
2535Oct 27 20:21:35 localhost epgd: Downloaded 'K1DOKU' for 2019-11-01 not changed, skipping.
2536Oct 27 20:21:36 localhost epgd: Downloaded 'KIKA' for 2019-11-01 with (186587) Bytes, changed since last load.
2537Oct 27 20:21:39 localhost epgd: Downloaded 'MDR' for 2019-11-01 with (84507) Bytes, changed since last load.
2538Oct 27 20:21:40 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-11-01]
2539Oct 27 20:21:40 localhost epgd: Downloaded 'N24' for 2019-11-01 failed, code: 0.
2540Oct 27 20:21:40 localhost epgd: Downloaded 'N24DOKU' for 2019-11-01 not changed, skipping.
2541Oct 27 20:21:40 localhost epgd: Downloaded 'NDR-HH' for 2019-11-01 with (77519) Bytes, changed since last load.
2542Oct 27 20:21:41 localhost epgd: Downloaded 'NICK' for 2019-11-01 with (57635) Bytes, changed since last load.
2543Oct 27 20:21:41 localhost epgd: Downloaded 'NTV' for 2019-11-01 not changed, skipping.
2544Oct 27 20:21:41 localhost epgd: Downloaded 'OE24TV' for 2019-11-01 not changed, skipping.
2545Oct 27 20:21:41 localhost epgd: Downloaded 'ORF1' for 2019-11-01 with (76499) Bytes, changed since last load.
2546Oct 27 20:21:42 localhost epgd: Downloaded 'ORF2' for 2019-11-01 not changed, skipping.
2547Oct 27 20:21:42 localhost epgd: Downloaded 'ORF3' for 2019-11-01 with (34961) Bytes, changed since last load.
2548Oct 27 20:21:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
2549Oct 27 20:21:43 localhost epgd: Downloaded 'ORFSP' for 2019-11-01 not changed, skipping.
2550Oct 27 20:21:44 localhost epgd: Downloaded 'PHOEN' for 2019-11-01 not changed, skipping.
2551Oct 27 20:21:44 localhost epgd: Downloaded 'PRO7' for 2019-11-01 with (89401) Bytes, changed since last load.
2552Oct 27 20:21:45 localhost epgd: Downloaded 'PRO7M' for 2019-11-01 with (64790) Bytes, changed since last load.
2553Oct 27 20:21:45 localhost epgd: Downloaded 'PULS4' for 2019-11-01 not changed, skipping.
2554Oct 27 20:21:45 localhost epgd: Downloaded 'RB-TV' for 2019-11-01 with (80290) Bytes, changed since last load.
2555Oct 27 20:21:45 localhost epgd: Downloaded 'RBB' for 2019-11-01 with (59913) Bytes, changed since last load.
2556Oct 27 20:21:46 localhost epgd: Downloaded 'RIC' for 2019-11-01 not changed, skipping.
2557Oct 27 20:21:46 localhost epgd: Downloaded 'RTL' for 2019-11-01 not changed, skipping.
2558Oct 27 20:21:46 localhost epgd: Downloaded 'RTL-N' for 2019-11-01 with (60002) Bytes, changed since last load.
2559Oct 27 20:21:46 localhost epgd: Downloaded 'RTL2' for 2019-11-01 with (28771) Bytes, changed since last load.
2560Oct 27 20:21:46 localhost epgd: Downloaded 'SAT1' for 2019-11-01 not changed, skipping.
2561Oct 27 20:21:46 localhost epgd: Downloaded 'SAT1G' for 2019-11-01 not changed, skipping.
2562Oct 27 20:21:47 localhost epgd: Downloaded 'SERVU' for 2019-11-01 with (75420) Bytes, changed since last load.
2563Oct 27 20:21:47 localhost epgd: Downloaded 'SIXX' for 2019-11-01 with (41854) Bytes, changed since last load.
2564Oct 27 20:21:47 localhost epgd: Downloaded 'SR' for 2019-11-01 not changed, skipping.
2565Oct 27 20:21:47 localhost epgd: Downloaded 'SUPER' for 2019-11-01 not changed, skipping.
2566Oct 27 20:21:47 localhost epgd: Downloaded 'SWRBW' for 2019-11-01 not changed, skipping.
2567Oct 27 20:21:47 localhost epgd: Downloaded 'TAG24' for 2019-11-01 with (51404) Bytes, changed since last load.
2568Oct 27 20:21:48 localhost epgd: Downloaded 'TELE5' for 2019-11-01 with (53234) Bytes, changed since last load.
2569Oct 27 20:21:48 localhost epgd: Downloaded 'TLC' for 2019-11-01 not changed, skipping.
2570Oct 27 20:21:48 localhost epgd: Downloaded 'TOGGO' for 2019-11-01 not changed, skipping.
2571Oct 27 20:21:48 localhost epgd: Downloaded 'VOX' for 2019-11-01 with (52510) Bytes, changed since last load.
2572Oct 27 20:21:48 localhost epgd: Downloaded 'WDR' for 2019-11-01 with (62883) Bytes, changed since last load.
2573Oct 27 20:21:49 localhost epgd: Downloaded 'WDWTV' for 2019-11-01 not changed, skipping.
2574Oct 27 20:21:50 localhost epgd: Downloaded 'ZDF' for 2019-11-01 with (95235) Bytes, changed since last load.
2575Oct 27 20:21:50 localhost epgd: Downloaded 'ZINFO' for 2019-11-01 with (95626) Bytes, changed since last load.
2576Oct 27 20:21:50 localhost epgd: Downloading images...
2577Oct 27 20:21:50 localhost epgd: Downloaded 0 images
2578Oct 27 20:21:50 localhost epgd: Updating 'tvm' day today+6 now
2579Oct 27 20:21:50 localhost epgd: Skipping day 6 for TVM plugin, since all days ar performed on day 0
2580Oct 27 20:21:50 localhost epgd: Updating 'tvsp' day today+6 now
2581Oct 27 20:21:50 localhost epgd: Downloaded '2NEO' for 2019-11-02 with (116640) Bytes, changed since last load.
2582Oct 27 20:21:51 localhost epgd: Downloaded '3SAT' for 2019-11-02 not changed, skipping.
2583Oct 27 20:21:51 localhost epgd: Downloaded 'ALPHA' for 2019-11-02 with (62832) Bytes, changed since last load.
2584Oct 27 20:21:51 localhost systemd[1]: Created slice User Slice of daniel.
2585Oct 27 20:21:51 localhost systemd[1]: Starting User Manager for UID 1000...
2586Oct 27 20:21:51 localhost systemd[1]: Started Session 3 of user daniel.
2587Oct 27 20:21:51 localhost systemd[4552]: Reached target Timers.
2588Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG network certificate management daemon.
2589Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG cryptographic agent and passphrase cache (restricted).
2590Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG cryptographic agent and passphrase cache.
2591Oct 27 20:21:51 localhost systemd[4552]: Starting D-Bus User Message Bus Socket.
2592Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG cryptographic agent (ssh-agent emulation).
2593Oct 27 20:21:51 localhost systemd[4552]: Reached target Paths.
2594Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG cryptographic agent and passphrase cache (access for web browsers).
2595Oct 27 20:21:51 localhost systemd[4552]: Listening on D-Bus User Message Bus Socket.
2596Oct 27 20:21:51 localhost systemd[4552]: Reached target Sockets.
2597Oct 27 20:21:51 localhost systemd[4552]: Reached target Basic System.
2598Oct 27 20:21:51 localhost systemd[4552]: Reached target Default.
2599Oct 27 20:21:51 localhost systemd[4552]: Startup finished in 50ms.
2600Oct 27 20:21:51 localhost epgd: Downloaded 'ANIXE' for 2019-11-02 not changed, skipping.
2601Oct 27 20:21:51 localhost systemd[1]: Started User Manager for UID 1000.
2602Oct 27 20:21:51 localhost epgd: Downloaded 'ARD' for 2019-11-02 with (94101) Bytes, changed since last load.
2603Oct 27 20:21:52 localhost epgd: Downloaded 'ARTE' for 2019-11-02 with (82291) Bytes, changed since last load.
2604Oct 27 20:21:53 localhost vdr: video: 23:37:52.723 +13 581 0/\ms 15+6+4 v-buf
2605Oct 27 20:21:55 localhost epgd: Downloaded 'ATV' for 2019-11-02 with (27544) Bytes, changed since last load.
2606Oct 27 20:21:55 localhost epgd: Downloaded 'ATV2' for 2019-11-02 with (38054) Bytes, changed since last load.
2607Oct 27 20:21:55 localhost epgd: Downloaded 'BBC' for 2019-11-02 not changed, skipping.
2608Oct 27 20:21:55 localhost epgd: Downloaded 'BR-S' for 2019-11-02 with (74074) Bytes, changed since last load.
2609Oct 27 20:21:55 localhost epgd: Downloaded 'CC' for 2019-11-02 with (96529) Bytes, changed since last load.
2610Oct 27 20:21:56 localhost epgd: Downloaded 'CNBC' for 2019-11-02 not changed, skipping.
2611Oct 27 20:21:56 localhost epgd: Downloaded 'DISNE' for 2019-11-02 with (71690) Bytes, changed since last load.
2612Oct 27 20:21:56 localhost epgd: Downloaded 'DMAX' for 2019-11-02 with (31316) Bytes, changed since last load.
2613Oct 27 20:21:56 localhost epgd: Downloaded 'EURON' for 2019-11-02 not changed, skipping.
2614Oct 27 20:21:57 localhost epgd: Downloaded 'FES' for 2019-11-02 with (74437) Bytes, changed since last load.
2615Oct 27 20:21:57 localhost epgd: Downloaded 'HR' for 2019-11-02 not changed, skipping.
2616Oct 27 20:21:57 localhost epgd: Downloaded 'K1' for 2019-11-02 with (58875) Bytes, changed since last load.
2617Oct 27 20:21:57 localhost epgd: Downloaded 'K1DOKU' for 2019-11-02 with (24276) Bytes, changed since last load.
2618Oct 27 20:21:57 localhost epgd: Downloaded 'KIKA' for 2019-11-02 not changed, skipping.
2619Oct 27 20:21:58 localhost epgd: Downloaded 'MDR' for 2019-11-02 with (72928) Bytes, changed since last load.
2620Oct 27 20:21:58 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-11-02]
2621Oct 27 20:21:58 localhost epgd: Downloaded 'N24' for 2019-11-02 failed, code: 0.
2622Oct 27 20:21:58 localhost epgd: Downloaded 'N24DOKU' for 2019-11-02 with (28472) Bytes, changed since last load.
2623Oct 27 20:21:58 localhost epgd: Downloaded 'NDR-HH' for 2019-11-02 with (72753) Bytes, changed since last load.
2624Oct 27 20:21:59 localhost epgd: Downloaded 'NICK' for 2019-11-02 with (57273) Bytes, changed since last load.
2625Oct 27 20:22:00 localhost epgd: Downloaded 'NTV' for 2019-11-02 with (45067) Bytes, changed since last load.
2626Oct 27 20:22:00 localhost epgd: Downloaded 'OE24TV' for 2019-11-02 not changed, skipping.
2627Oct 27 20:22:00 localhost epgd: Downloaded 'ORF1' for 2019-11-02 with (96723) Bytes, changed since last load.
2628Oct 27 20:22:00 localhost epgd: Downloaded 'ORF2' for 2019-11-02 with (51257) Bytes, changed since last load.
2629Oct 27 20:22:01 localhost epgd: Downloaded 'ORF3' for 2019-11-02 not changed, skipping.
2630Oct 27 20:22:01 localhost epgd: Downloaded 'ORFSP' for 2019-11-02 not changed, skipping.
2631Oct 27 20:22:01 localhost epgd: Downloaded 'PHOEN' for 2019-11-02 not changed, skipping.
2632Oct 27 20:22:01 localhost epgd: Downloaded 'PRO7' for 2019-11-02 with (86158) Bytes, changed since last load.
2633Oct 27 20:22:02 localhost epgd: Downloaded 'PRO7M' for 2019-11-02 not changed, skipping.
2634Oct 27 20:22:02 localhost epgd: Downloaded 'PULS4' for 2019-11-02 not changed, skipping.
2635Oct 27 20:22:02 localhost epgd: Downloaded 'RB-TV' for 2019-11-02 with (73547) Bytes, changed since last load.
2636Oct 27 20:22:04 localhost epgd: Downloaded 'RBB' for 2019-11-02 not changed, skipping.
2637Oct 27 20:22:04 localhost epgd: Downloaded 'RIC' for 2019-11-02 with (23785) Bytes, changed since last load.
2638Oct 27 20:22:04 localhost epgd: Downloaded 'RTL' for 2019-11-02 not changed, skipping.
2639Oct 27 20:22:04 localhost epgd: Downloaded 'RTL-N' for 2019-11-02 with (43728) Bytes, changed since last load.
2640Oct 27 20:22:05 localhost epgd: Downloaded 'RTL2' for 2019-11-02 with (34000) Bytes, changed since last load.
2641Oct 27 20:22:05 localhost epgd: Downloaded 'SAT1' for 2019-11-02 with (28948) Bytes, changed since last load.
2642Oct 27 20:22:06 localhost epgd: Downloaded 'SAT1G' for 2019-11-02 with (55028) Bytes, changed since last load.
2643Oct 27 20:22:07 localhost epgd: Downloaded 'SERVU' for 2019-11-02 with (71526) Bytes, changed since last load.
2644Oct 27 20:22:07 localhost epgd: Downloaded 'SIXX' for 2019-11-02 with (39540) Bytes, changed since last load.
2645Oct 27 20:22:07 localhost epgd: Downloaded 'SR' for 2019-11-02 not changed, skipping.
2646Oct 27 20:22:07 localhost epgd: Downloaded 'SUPER' for 2019-11-02 with (39736) Bytes, changed since last load.
2647Oct 27 20:22:07 localhost epgd: Downloaded 'SWRBW' for 2019-11-02 with (83608) Bytes, changed since last load.
2648Oct 27 20:22:08 localhost epgd: Downloaded 'TAG24' for 2019-11-02 not changed, skipping.
2649Oct 27 20:22:08 localhost epgd: Downloaded 'TELE5' for 2019-11-02 with (54400) Bytes, changed since last load.
2650Oct 27 20:22:08 localhost epgd: Downloaded 'TLC' for 2019-11-02 with (40306) Bytes, changed since last load.
2651Oct 27 20:22:09 localhost epgd: Downloaded 'TOGGO' for 2019-11-02 with (35407) Bytes, changed since last load.
2652Oct 27 20:22:09 localhost epgd: Downloaded 'VOX' for 2019-11-02 not changed, skipping.
2653Oct 27 20:22:09 localhost epgd: Downloaded 'WDR' for 2019-11-02 with (67517) Bytes, changed since last load.
2654Oct 27 20:22:10 localhost epgd: Downloaded 'WDWTV' for 2019-11-02 not changed, skipping.
2655Oct 27 20:22:10 localhost epgd: Downloaded 'ZDF' for 2019-11-02 with (125392) Bytes, changed since last load.
2656Oct 27 20:22:11 localhost epgd: Downloaded 'ZINFO' for 2019-11-02 not changed, skipping.
2657Oct 27 20:22:11 localhost epgd: Downloading images...
2658Oct 27 20:22:11 localhost epgd: Downloaded 1 images
2659Oct 27 20:22:11 localhost epgd: Updating 'tvm' day today+7 now
2660Oct 27 20:22:11 localhost epgd: Skipping day 7 for TVM plugin, since all days ar performed on day 0
2661Oct 27 20:22:11 localhost epgd: Updating 'tvsp' day today+7 now
2662Oct 27 20:22:11 localhost epgd: Downloaded '2NEO' for 2019-11-03 with (117873) Bytes, changed since last load.
2663Oct 27 20:22:11 localhost epgd: Downloaded '3SAT' for 2019-11-03 not changed, skipping.
2664Oct 27 20:22:11 localhost epgd: Downloaded 'ALPHA' for 2019-11-03 not changed, skipping.
2665Oct 27 20:22:11 localhost epgd: Downloaded 'ANIXE' for 2019-11-03 not changed, skipping.
2666Oct 27 20:22:11 localhost epgd: Downloaded 'ARD' for 2019-11-03 not changed, skipping.
2667Oct 27 20:22:11 localhost epgd: Downloaded 'ARTE' for 2019-11-03 with (87001) Bytes, changed since last load.
2668Oct 27 20:22:12 localhost epgd: Downloaded 'ATV' for 2019-11-03 not changed, skipping.
2669Oct 27 20:22:12 localhost epgd: Downloaded 'ATV2' for 2019-11-03 not changed, skipping.
2670Oct 27 20:22:12 localhost epgd: Downloaded 'BBC' for 2019-11-03 not changed, skipping.
2671Oct 27 20:22:12 localhost epgd: Downloaded 'BR-S' for 2019-11-03 with (76137) Bytes, changed since last load.
2672Oct 27 20:22:12 localhost epgd: Downloaded 'CC' for 2019-11-03 with (95532) Bytes, changed since last load.
2673Oct 27 20:22:13 localhost epgd: Downloaded 'CNBC' for 2019-11-03 not changed, skipping.
2674Oct 27 20:22:13 localhost epgd: Downloaded 'DISNE' for 2019-11-03 with (74558) Bytes, changed since last load.
2675Oct 27 20:22:13 localhost epgd: Downloaded 'DMAX' for 2019-11-03 with (29427) Bytes, changed since last load.
2676Oct 27 20:22:13 localhost epgd: Downloaded 'EURON' for 2019-11-03 not changed, skipping.
2677Oct 27 20:22:13 localhost epgd: Downloaded 'FES' for 2019-11-03 with (93609) Bytes, changed since last load.
2678Oct 27 20:22:14 localhost epgd: Downloaded 'HR' for 2019-11-03 with (93163) Bytes, changed since last load.
2679Oct 27 20:22:15 localhost epgd: Downloaded 'K1' for 2019-11-03 not changed, skipping.
2680Oct 27 20:22:15 localhost epgd: Downloaded 'K1DOKU' for 2019-11-03 not changed, skipping.
2681Oct 27 20:22:15 localhost epgd: Downloaded 'KIKA' for 2019-11-03 with (142604) Bytes, changed since last load.
2682Oct 27 20:22:16 localhost epgd: Downloaded 'MDR' for 2019-11-03 not changed, skipping.
2683Oct 27 20:22:16 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-11-03]
2684Oct 27 20:22:16 localhost epgd: Downloaded 'N24' for 2019-11-03 failed, code: 0.
2685Oct 27 20:22:17 localhost epgd: Downloaded 'N24DOKU' for 2019-11-03 with (33239) Bytes, changed since last load.
2686Oct 27 20:22:17 localhost epgd: Downloaded 'NDR-HH' for 2019-11-03 not changed, skipping.
2687Oct 27 20:22:17 localhost epgd: Downloaded 'NICK' for 2019-11-03 with (52274) Bytes, changed since last load.
2688Oct 27 20:22:17 localhost epgd: Downloaded 'NTV' for 2019-11-03 with (44859) Bytes, changed since last load.
2689Oct 27 20:22:18 localhost epgd: Downloaded 'OE24TV' for 2019-11-03 not changed, skipping.
2690Oct 27 20:22:18 localhost epgd: Downloaded 'ORF1' for 2019-11-03 with (66887) Bytes, changed since last load.
2691Oct 27 20:22:18 localhost epgd: Downloaded 'ORF2' for 2019-11-03 not changed, skipping.
2692Oct 27 20:22:18 localhost epgd: Downloaded 'ORF3' for 2019-11-03 not changed, skipping.
2693Oct 27 20:22:18 localhost epgd: Downloaded 'ORFSP' for 2019-11-03 not changed, skipping.
2694Oct 27 20:22:18 localhost epgd: Downloaded 'PHOEN' for 2019-11-03 not changed, skipping.
2695Oct 27 20:22:18 localhost epgd: Downloaded 'PRO7' for 2019-11-03 with (42638) Bytes, changed since last load.
2696Oct 27 20:22:18 localhost epgd: Downloaded 'PRO7M' for 2019-11-03 not changed, skipping.
2697Oct 27 20:22:18 localhost epgd: Downloaded 'PULS4' for 2019-11-03 not changed, skipping.
2698Oct 27 20:22:18 localhost epgd: Downloaded 'RB-TV' for 2019-11-03 not changed, skipping.
2699Oct 27 20:22:18 localhost epgd: Downloaded 'RBB' for 2019-11-03 not changed, skipping.
2700Oct 27 20:22:19 localhost epgd: Downloaded 'RIC' for 2019-11-03 not changed, skipping.
2701Oct 27 20:22:19 localhost epgd: Downloaded 'RTL' for 2019-11-03 not changed, skipping.
2702Oct 27 20:22:19 localhost epgd: Downloaded 'RTL-N' for 2019-11-03 with (44717) Bytes, changed since last load.
2703Oct 27 20:22:19 localhost epgd: Downloaded 'RTL2' for 2019-11-03 with (50905) Bytes, changed since last load.
2704Oct 27 20:22:20 localhost epgd: Downloaded 'SAT1' for 2019-11-03 with (29506) Bytes, changed since last load.
2705Oct 27 20:22:21 localhost epgd: Downloaded 'SAT1G' for 2019-11-03 with (69846) Bytes, changed since last load.
2706Oct 27 20:22:22 localhost epgd: Downloaded 'SERVU' for 2019-11-03 not changed, skipping.
2707Oct 27 20:22:22 localhost epgd: Downloaded 'SIXX' for 2019-11-03 with (47405) Bytes, changed since last load.
2708Oct 27 20:22:23 localhost epgd: Downloaded 'SR' for 2019-11-03 with (73676) Bytes, changed since last load.
2709Oct 27 20:22:23 localhost epgd: Downloaded 'SUPER' for 2019-11-03 with (36409) Bytes, changed since last load.
2710Oct 27 20:22:23 localhost epgd: Downloaded 'SWRBW' for 2019-11-03 with (74037) Bytes, changed since last load.
2711Oct 27 20:22:24 localhost epgd: Downloaded 'TAG24' for 2019-11-03 not changed, skipping.
2712Oct 27 20:22:24 localhost epgd: Downloaded 'TELE5' for 2019-11-03 with (43341) Bytes, changed since last load.
2713Oct 27 20:22:25 localhost epgd: Downloaded 'TLC' for 2019-11-03 not changed, skipping.
2714Oct 27 20:22:25 localhost epgd: Downloaded 'TOGGO' for 2019-11-03 not changed, skipping.
2715Oct 27 20:22:25 localhost epgd: Downloaded 'VOX' for 2019-11-03 not changed, skipping.
2716Oct 27 20:22:25 localhost epgd: Downloaded 'WDR' for 2019-11-03 with (72023) Bytes, changed since last load.
2717Oct 27 20:22:27 localhost epgd: Downloaded 'WDWTV' for 2019-11-03 not changed, skipping.
2718Oct 27 20:22:27 localhost epgd: Downloaded 'ZDF' for 2019-11-03 with (122000) Bytes, changed since last load.
2719Oct 27 20:22:27 localhost epgd: Downloaded 'ZINFO' for 2019-11-03 not changed, skipping.
2720Oct 27 20:22:27 localhost epgd: Downloading images...
2721Oct 27 20:22:27 localhost epgd: Downloaded 1 images
2722Oct 27 20:22:27 localhost epgd: EPG Update finished, loaded 236 files (15.411 MB), 260 non-updates skipped, 0 rejected due to format error.
2723Oct 27 20:22:27 localhost epgd: Calling sd_notify(STATUS=Ready)
2724Oct 27 20:22:27 localhost epgd: Starting 'update' episode download ...
2725Oct 27 20:22:28 localhost epgd: Got 'Setting encoding to utf8'
2726Oct 27 20:22:28 localhost epgd: Requesting episode changes of last 753 minutes
2727Oct 27 20:22:28 localhost epgd: Received 1 episode files
2728Oct 27 20:22:29 localhost epgd: Starting episode lookup ...
2729Oct 27 20:22:29 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [ROGERDERGERADESEINABSCHLUSSZEUGNISIMARCHÄOLOGIESTUDIUMERHALTENHATBEKOMMTVONDERFAMILIEEINEHARTEABFUHRNIEMANDWÜRDIGTSEINEERFOLGEDENNSIESEIENALLENURERLOGENUNDERSCHUMMELTFRANCINEBERUHIGTROGERUNDUNTERSTÜ]
2730Oct 27 20:22:29 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [ROGERDERGERADESEINABSCHLUSSZEUGNISIMARCHÄOLOGIESTUDIUMERHALTENHATBEKOMMTVONDERFAMILIEEINEHARTEABFUHRNIEMANDWÜRDIGTSEINEERFOLGEDENNSIESEIENALLENURERLOGENUNDERSCHUMMELTFRANCINEBERUHIGTROGERUNDUNTERSTÜ]
2731Oct 27 20:22:32 localhost vdr: [1799] [softhddev]SetVolumeDevice: 60
2732Oct 27 20:22:32 localhost vdr: [1799] [softhddev]CreateOsd: left 384, top 918, level 0, using OpenGL OSD support
2733Oct 27 20:22:32 localhost vdr: [1799] [softhddev]cOglOsd osdLeft 384 osdTop 918 screenWidth 1920 screenHeight 1080
2734Oct 27 20:22:32 localhost vdr: [5045] animator thread thread started (pid=1799, tid=5045, prio=high)
2735Oct 27 20:22:32 localhost vdr: [1799] [softhddev]SetVolumeDevice: 65
2736Oct 27 20:22:32 localhost vdr: [1799] [softhddev]SetVolumeDevice: 70
2737Oct 27 20:22:33 localhost vdr: [5045] animator thread thread ended (pid=1799, tid=5045)
2738Oct 27 20:22:34 localhost vdr: [1799] [softhddev]SetVolumeDevice: 65
2739Oct 27 20:22:34 localhost vdr: [1799] [softhddev]CreateOsd: left 384, top 918, level 0, using OpenGL OSD support
2740Oct 27 20:22:34 localhost vdr: [1799] [softhddev]cOglOsd osdLeft 384 osdTop 918 screenWidth 1920 screenHeight 1080
2741Oct 27 20:22:34 localhost vdr: [5181] animator thread thread started (pid=1799, tid=5181, prio=high)
2742Oct 27 20:22:35 localhost vdr: [5181] animator thread thread ended (pid=1799, tid=5181)
2743Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIEUNDJOYGEHENMITSIMONAUNDSTEPHENESSENUNDKURZBEVORDERNACHTISCHKOMMTVERABSCHIEDENSIESICHSCHNELLDASIEMORGENSFRÃœHARBEITENMÃœSSENZUMDRITTENMALBLEIBENDAMITSTEPHENUNDSIMONAAUFEINERRESTAURANTRECHNUNGSITZEN]
2744Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIEUNDJOYGEHENMITSIMONAUNDSTEPHENESSENUNDKURZBEVORDERNACHTISCHKOMMTVERABSCHIEDENSIESICHSCHNELLDASIEMORGENSFRÃœHARBEITENMÃœSSENZUMDRITTENMALBLEIBENDAMITSTEPHENUNDSIMONAAUFEINERRESTAURANTRECHNUNGSITZEN]
2745Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIESGEHALTSERHÖHUNGISTINGEFAHRFÜRLEHRERGILTJETZTDASLEISTUNGSPRINZIPSEINEKLASSEMUSSEINENBESTIMMTENNOTENDURCHSCHNITTERREICHENANSONSTENFÄLLTDIEERHÖHUNGFÜRIHNAUSDUMMERWEISESITZTFELDMANINSEINERKLASSE]
2746Oct 27 20:22:36 localhost epgd: message repeated 3 times: [ Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIESGEHALTSERHÖHUNGISTINGEFAHRFÜRLEHRERGILTJETZTDASLEISTUNGSPRINZIPSEINEKLASSEMUSSEINENBESTIMMTENNOTENDURCHSCHNITTERREICHENANSONSTENFÄLLTDIEERHÖHUNGFÜRIHNAUSDUMMERWEISESITZTFELDMANINSEINERKLASSE]]
2747Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIEUNDJOYGEHENMITSIMONAUNDSTEPHENESSENUNDKURZBEVORDERNACHTISCHKOMMTVERABSCHIEDENSIESICHSCHNELLDASIEMORGENSFRÃœHARBEITENMÃœSSENZUMDRITTENMALBLEIBENDAMITSTEPHENUNDSIMONAAUFEINERRESTAURANTRECHNUNGSITZEN]
2748Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIESGEHALTSERHÖHUNGISTINGEFAHRFÜRLEHRERGILTJETZTDASLEISTUNGSPRINZIPSEINEKLASSEMUSSEINENBESTIMMTENNOTENDURCHSCHNITTERREICHENANSONSTENFÄLLTDIEERHÖHUNGFÜRIHNAUSDUMMERWEISESITZTFELDMANINSEINERKLASSE]
2749Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIESGEHALTSERHÖHUNGISTINGEFAHRFÜRLEHRERGILTJETZTDASLEISTUNGSPRINZIPSEINEKLASSEMUSSEINENBESTIMMTENNOTENDURCHSCHNITTERREICHENANSONSTENFÄLLTDIEERHÖHUNGFÜRIHNAUSDUMMERWEISESITZTFELDMANINSEINERKLASSE]
2750Oct 27 20:22:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
2751Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [CARTMANWIRDSOFORTSTUTZIGALSEINMUSLIMISCHERJUNGENACHSOUTHPARKZIEHTUNDSOBEGINNTEREINEAUFWÄNDIGERECHERCHEDIEZUMERGEBNISHATDASOFFENBARTATSÄCHLICHEINANSCHLAGAUFHILLARYCLINTONWÄHRENDIHRESBESUCHSINSOUTHPARK]
2752Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [CARTMANWIRDSOFORTSTUTZIGALSEINMUSLIMISCHERJUNGENACHSOUTHPARKZIEHTUNDSOBEGINNTEREINEAUFWÄNDIGERECHERCHEDIEZUMERGEBNISHATDASOFFENBARTATSÄCHLICHEINANSCHLAGAUFHILLARYCLINTONWÄHRENDIHRESBESUCHSINSOUTHPARK]
2753Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATDIEJUNGSBESCHLIEßENDIESEZUNÄCHSTZUT]
2754Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATDIEJUNGSBESCHLIEßENDIESEZUNÄCHSTZUT]
2755Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [IMMERWENNMSGARRISONEINENPARTNERVERLORENHATISTSIESOFRUSTRIERTDASSSIEIHREWUTANDENKINDERNIHRERKLASSEAUSLÄSSTDIESERZUSTANDÄNDERTSICHGRUNDLEGENDALSMSGARRISONINEINERLESBENBARIHREGEFÜHLEFÜRSEIGENEGESCHLEC]
2756Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [IMMERWENNMSGARRISONEINENPARTNERVERLORENHATISTSIESOFRUSTRIERTDASSSIEIHREWUTANDENKINDERNIHRERKLASSEAUSLÄSSTDIESERZUSTANDÄNDERTSICHGRUNDLEGENDALSMSGARRISONINEINERLESBENBARIHREGEFÜHLEFÜRSEIGENEGESCHLEC]
2757Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [DIESTADTWIRDVONEINERHARLEYMOTORRADGANGHEIMGESUCHTDIEMITIHRENMASCHINENSTÄNDIGLAUTDURCHDIESTRAßENCRUISENCARTMANUNDDIEJUNGSHALTENDIESESPUBERTÄREPROLOTREIBENFÜRHÖCHSTSCHWUCHTELHAFTUNDWOLLENDIEBIKERAUSDERST]
2758Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [DIESTADTWIRDVONEINERHARLEYMOTORRADGANGHEIMGESUCHTDIEMITIHRENMASCHINENSTÄNDIGLAUTDURCHDIESTRAßENCRUISENCARTMANUNDDIEJUNGSHALTENDIESESPUBERTÄREPROLOTREIBENFÜRHÖCHSTSCHWUCHTELHAFTUNDWOLLENDIEBIKERAUSDERST]
2759Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 207) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERMEHR]
2760Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 207) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERMEHR]
2761Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [DIEJUNGSVONSOUTHPARKSINDDEMNEUESTENFUNTRENDVERFALLENCHINPOKOMONEINCARTOONAUSJAPANDIEERWACHSENENMACHENSICHSEHRSPÄTERSTGEDANKENÜBERDIEVERÄNDERUNGENIMVERHALTENIHRERKINDERDIENUNALLEPLÖTZLICHJAPANISCHSP]
2762Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [DIEJUNGSVONSOUTHPARKSINDDEMNEUESTENFUNTRENDVERFALLENCHINPOKOMONEINCARTOONAUSJAPANDIEERWACHSENENMACHENSICHSEHRSPÄTERSTGEDANKENÜBERDIEVERÄNDERUNGENIMVERHALTENIHRERKINDERDIENUNALLEPLÖTZLICHJAPANISCHSP]
2763Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATDIEJUNGSBESCHLIEßENDIESEZUNÄCHSTZUT]
2764Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATDIEJUNGSBESCHLIEßENDIESEZUNÄCHSTZUT]
2765Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 207) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERMEHR]
2766Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 207) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERMEHR]
2767Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [SHELLYSOLLAUFCARTMANAUFPASSENWÄHRENDSEINEMUTTERAUFEINERPARTYISTWÄHRENDCARTMANUNDSHELLYLOSZIEHENUMSHELLYSEXFREUNDEINSAUSZUWISCHENFEIERTCARTMANSROLLIGEMIEZEINDERZWISCHENZEITEINEWILDEKATZENORGIEINDEMLEER]
2768Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [SHELLYSOLLAUFCARTMANAUFPASSENWÄHRENDSEINEMUTTERAUFEINERPARTYISTWÄHRENDCARTMANUNDSHELLYLOSZIEHENUMSHELLYSEXFREUNDEINSAUSZUWISCHENFEIERTCARTMANSROLLIGEMIEZEINDERZWISCHENZEITEINEWILDEKATZENORGIEINDEMLEER]
2769Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [AUFDERMETEORITENSCHAUERPARTYMUSSSTANMITDEN3GRÖßTENSTREBERNDERSCHULEIMKELLERSPIELENWÄHRENDSEINEELTERNOBENFEIERNSTANSVATERRANDYUNDGERALDFINDENSICHNACKTIMWHIRLPOOLWIEDERUNDBESCHLIEßENIHRENSEXPHANTASIEN]
2770Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [AUFDERMETEORITENSCHAUERPARTYMUSSSTANMITDEN3GRÖßTENSTREBERNDERSCHULEIMKELLERSPIELENWÄHRENDSEINEELTERNOBENFEIERNSTANSVATERRANDYUNDGERALDFINDENSICHNACKTIMWHIRLPOOLWIEDERUNDBESCHLIEßENIHRENSEXPHANTASIEN]
2771Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [NACHDEMDIEPANFLÖTENSPIELERVONDENSTRAßENGEHOLTWURDENBRICHTÜBERALLINDENSTÄDTENDASCHAOSAUSRIESIGEMEERSCHWEINCHENATTACKIERENDIEBEWOHNERDIEJUNGSWURDENVONDERNATIONALENSICHERHEITNACHPERUGEBRACHTUMDENGRUNDD]
2772Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 205) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATALSOBESCHLIEßENDIEJUNGSDIESEZUNÄCH]
2773Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [MRGARRISONLÄDTDENSEXUELLENBELÄSTIGUNGSPANDAINDENUNTERRICHTEINDAMITDIESCHÜLERALLESÜBERGESETZEZURVERHINDERUNGVONSEXUELLERBELÄSTIGUNGERFAHRENWEGENEINESZWEIDEUTIGENKRAFTAUSDRUCKSVERKLAGTCARTMANSTANDANNAUFS]
2774Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 205) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATALSOBESCHLIEßENDIEJUNGSDIESEZUNÄCH]
2775Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 204) [DIESTADTWIRDVONEINERHARLEYMOTORRADGANGHEIMGESUCHTDIEMITIHRENMASCHINENSTÄNDIGLAUTDURCHDIESTRAßENCRUISENCARTMANUNDDIEJUNGSHALTENDIESESPUBERTÄREPROLOTREIBENFÜRHÖCHSTSCHWUCHTELHAFTUNDWOLLENDIEBIKERAUSDER]
2776Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 205) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERME]
2777Oct 27 20:22:50 localhost epgd: Lookup done for 2292 series, matched 19304 parts by compare and 807 parts by lv in 21 seconds; Updated 396
2778Oct 27 20:22:50 localhost epgd: Calling 'mergeepg'
2779Oct 27 20:22:53 localhost vdr: video: 23:38:52.723 +13 581 0/\ms 15+6+4 v-buf
2780Oct 27 20:23:37 localhost vdr: [1932] changing caids of channel 6294 (UHD1 by ASTRA / HD+) from 0 to 1830,1843,1860,186A,186D,9C4,98C,98D,1842,4B64
2781Oct 27 20:23:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
2782Oct 27 20:23:53 localhost vdr: video: 23:39:52.723 +13 581 0/\ms 12+6+4 v-buf
2783Oct 27 20:24:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
2784Oct 27 20:24:53 localhost vdr: video: 23:40:52.723 +13 645 0/\ms 15+6+4 v-buf
2785Oct 27 20:25:01 localhost vdr: [1932] changing pids of channel 8112 (Sky Cinema Action HD) from 767+767=27:0;771=deu@106,772=eng@106:0:0 to 767+767=27:0;771=deu@106:0:0
2786Oct 27 20:25:02 localhost vdr: [1932] changing portal name of channel 8146 (Sky Sport 2) from '' to 'Formel 1'
2787Oct 27 20:25:02 localhost vdr: [1932] changing name of channel 8196 from '18:00 Formel1 PK,;' to 'F1 Race Control,;'
2788Oct 27 20:25:02 localhost vdr: [1932] linking channel 8146 (Sky Sport 2) from none to 8196